Align C4-dicarboxylate transport protein 2 (characterized)
to candidate GFF2281 PS417_11630 sodium:dicarboxylate symporter
Query= SwissProt::Q9I4F5 (436 letters) >FitnessBrowser__WCS417:GFF2281 Length = 434 Score = 398 bits (1023), Expect = e-115 Identities = 208/415 (50%), Positives = 281/415 (67%), Gaps = 3/415 (0%) Query: 3 KQPFYKSLYVQVLVAIAIGIALGHWYPETAVAMKPFGDGFVKLIKMAIAPIIFCTVVTGI 62 K+P YK L QV+ A+ +GIA G PE A K GD F+KLIK A+AP++F TVV GI Sbjct: 7 KKPLYKDLTFQVIAAMFLGIAFGFLAPELAAGFKILGDIFLKLIKTAVAPLVFFTVVHGI 66 Query: 63 AGMQSMKSVGKTGGMALLYFEVVSTVALIIGLVVVNVVQPGAGMH-VDPNTLDTSKIAAY 121 A +K VGK G AL+YFEVVST+AL IGL+ N++Q G+GMH P++ + +A Sbjct: 67 ASAGDIKRVGKVGLRALIYFEVVSTIALAIGLLWGNLLQIGSGMHDAHPSSAAATAASAA 126 Query: 122 AAAGEKQ-STVDFLMNVIPGTVVGAFANGDILQVLFFSVLFGYALHRLGSYGKPVFEF-I 179 A G ST+DF+ + P VGAFA G +LQVL SVLFG+AL L + V E + Sbjct: 127 VAKGHAPASTLDFIYGIFPDNFVGAFAGGQLLQVLVISVLFGFALLALKPERREVIEDGL 186 Query: 180 ERVSHVMFNIINVIMKVAPIGAFGAMAFTIGAYGVGSLVQLGQLMLCFYITCILFVLIVL 239 R+S F IN+IMK AP+GAFG++A+ +G+ G L+ L L+L FY+ F+ +VL Sbjct: 187 NRISECFFEFINLIMKFAPLGAFGSVAYAVGSNGTAVLMSLANLVLMFYVGIAFFICVVL 246 Query: 240 GGIARAHGFSILRFIRYIREELLIVLGTSSSESALPRMIDKMEKLGCNKSVVGLVIPTGY 299 G + R GFS+ RF+ YI++E+ IVLGT+SSESALPR++ K+EK GC+K VGLV+PTGY Sbjct: 247 GAVCRLSGFSLWRFLTYIKDEIFIVLGTASSESALPRLLQKLEKFGCSKQSVGLVLPTGY 306 Query: 300 SFNLDGTSIYLTMAAVFIAQATDTPMDITHQITLLLVLLIASKGAAGVTGSGFIVLAATL 359 +FNLDGTSIY+++ +FIA A P+ Q+ ++ ++L+ SKGAA V+G F+V AAT+ Sbjct: 307 AFNLDGTSIYMSLCVLFIANAYGVPLSWEQQLGIIAIMLVTSKGAAAVSGGSFVVFAATV 366 Query: 360 SAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSKWCKQLDEGTLQRE 414 +A+G LP GLAL+ G+ RFMS A A N +GN VATVVVSKW + + T Q E Sbjct: 367 TAIGVLPAEGLALLFGVYRFMSMAIATCNTIGNSVATVVVSKWSGEFSQQTAQDE 421 Lambda K H 0.325 0.140 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 434 Length adjustment: 32 Effective length of query: 404 Effective length of database: 402 Effective search space: 162408 Effective search space used: 162408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory