Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate GFF2365 PS417_12060 sugar ABC transporter permease
Query= uniprot:A0A161GM94 (322 letters) >FitnessBrowser__WCS417:GFF2365 Length = 325 Score = 200 bits (508), Expect = 4e-56 Identities = 108/308 (35%), Positives = 177/308 (57%), Gaps = 2/308 (0%) Query: 17 LRRFLDDWVMLLAAIGIFVLCTLMIDNFLSPLNMRGLGLAISTTGIAACTMLYCLASGHF 76 LR LD + + L I + V+ + F++ N + S GI A M Y + + Sbjct: 18 LRLSLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGI 77 Query: 77 DLSVGSVIACAGVVAAVVMRDTNSVFLGISAALVMGLIVGLINGIVIAKLRVNALITTLA 136 DLSVGS++A AG+ +A+V + +SA + G ++G++NG ++A L + + TL Sbjct: 78 DLSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLG 137 Query: 137 TMQIVRGLAYIFANGKAVGVSQESFFVFGNGQMFGVPVPILITIVCFLFFGWLLNYTTYG 196 + I RG+ +I +G + +++ G G++ + VPI+I V L F +L YTTYG Sbjct: 138 MLSIARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYG 197 Query: 197 RNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMIGQGFELT 256 R A+GGN+++A +G+ V + ++ V G++ LAGV+L++R TS P G +EL Sbjct: 198 RYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELD 257 Query: 257 VISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLAVVI 316 I+A V+GG SLSGG G I + G L++ +I N +NL + ++YQ V +G I++ AV+I Sbjct: 258 AIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVLI 317 Query: 317 D--RLKQR 322 D R K+R Sbjct: 318 DVWRKKKR 325 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 325 Length adjustment: 28 Effective length of query: 294 Effective length of database: 297 Effective search space: 87318 Effective search space used: 87318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory