Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= uniprot:A0A161GM94 (322 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 206 bits (524), Expect = 6e-58 Identities = 111/295 (37%), Positives = 175/295 (59%), Gaps = 3/295 (1%) Query: 31 IGIFVLCTLMI---DNFLSPLNMRGLGLAISTTGIAACTMLYCLASGHFDLSVGSVIACA 87 +G+ V+ +MI D FL+ N+ + +S I A M + +G DLSVG V+A + Sbjct: 36 VGLVVVTLVMILASDTFLTASNLSNIARQVSINAIIAVGMTCVILTGGIDLSVGPVMALS 95 Query: 88 GVVAAVVMRDTNSVFLGISAALVMGLIVGLINGIVIAKLRVNALITTLATMQIVRGLAYI 147 G + A +M L I A +++G+ G+ NG+ +A L + +I TLATM I RGL + Sbjct: 96 GTLTAGLMVAGLPPGLAIGAGMLIGVAFGIGNGLFVAYLHMPPIIVTLATMGIARGLGLM 155 Query: 148 FANGKAVGVSQESFFVFGNGQMFGVPVPILITIVCFLFFGWLLNYTTYGRNTMAIGGNQE 207 + +G + + F FG +FG+ VPILI ++ +L LL +T GR AIGGN+E Sbjct: 156 YTDGYPISGLPDWFAFFGRESLFGIQVPILIMLLTYLVAYVLLQHTRIGRYIYAIGGNEE 215 Query: 208 AALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMIGQGFELTVISACVLGGVS 267 A L+GV R K++++ + G+ A+AG++L SR+ SGQP G FEL I+A VLGG S Sbjct: 216 AVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQPNAGVSFELDAIAAVVLGGAS 275 Query: 268 LSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLAVVIDRLKQR 322 ++GG G+I + G ++L ++ N +N+ + + Q VI+G I+LLA+ I R + + Sbjct: 276 IAGGRGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQSVIKGGIILLAIFISRQRHK 330 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 330 Length adjustment: 28 Effective length of query: 294 Effective length of database: 302 Effective search space: 88788 Effective search space used: 88788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory