Align L-arabinolactonase (EC 3.1.1.15) / D-galactonolactonase (EC 3.1.1.25) (characterized)
to candidate GFF2160 PS417_11020 gluconolaconase
Query= reanno::pseudo5_N2C3_1:AO356_20235 (291 letters) >FitnessBrowser__WCS417:GFF2160 Length = 287 Score = 474 bits (1220), Expect = e-138 Identities = 224/291 (76%), Positives = 248/291 (85%), Gaps = 4/291 (1%) Query: 1 MKWTAVTEHRAKLGEGPFWDAPTQALYWVDIAGKQALRLIGANVEIWQMPEHVSAFIPTQ 60 M AVT HRA+LGEGPFWDAPTQALYWV+IAGKQALRL+G +++WQ+PEHVSAFIP + Sbjct: 1 MSCIAVTPHRAQLGEGPFWDAPTQALYWVNIAGKQALRLMGGQLQVWQLPEHVSAFIPCE 60 Query: 61 SGDALVTLSSGVYRLDLDSPGLEPRLTLLCMADPQPGNRANEARCDPQGQLWLGTMQNNI 120 SGDALVTLSSGVYRLDL + L TLLC+ADPQPGNR NEARCD G+LWLGTMQNNI Sbjct: 61 SGDALVTLSSGVYRLDLATEAL----TLLCVADPQPGNRGNEARCDASGRLWLGTMQNNI 116 Query: 121 GAEGEDLPIEHRSGGLFRVGSDGRVLPLLRGLGIPNTLLWSPDGTTVYFGDSLDGTVYRH 180 G +GEDLPI RSGGLFR+ +D +V PLL GLGIPNTLLWS DG V+FGDSLDGT+YRH Sbjct: 117 GEQGEDLPITRRSGGLFRIDADAQVTPLLSGLGIPNTLLWSDDGRHVHFGDSLDGTLYRH 176 Query: 181 FIYPEGNLAPAEVWFGPHPRGGPDGSAMDARGYIWNARWDGSCLLRLTPDGQVDRVIELP 240 I P+G L PA+ WFGPH RGGPDGSAMD GYIWNARWDGSCLLRLTPDG+VDR++ELP Sbjct: 177 AIQPDGQLDPAQTWFGPHERGGPDGSAMDVDGYIWNARWDGSCLLRLTPDGEVDRIVELP 236 Query: 241 VSRPTSCVFGGEDLKTLYITSAASPLGHPLDGAVLSMRVDVPGVACTRFAG 291 VSRPTSCV GG +L TLYITSAASPL HPLDGAVL+M VDVPG C RFAG Sbjct: 237 VSRPTSCVLGGPNLTTLYITSAASPLDHPLDGAVLAMEVDVPGKPCHRFAG 287 Lambda K H 0.319 0.140 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 37 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 287 Length adjustment: 26 Effective length of query: 265 Effective length of database: 261 Effective search space: 69165 Effective search space used: 69165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory