Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate GFF2700 PS417_13775 dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__WCS417:GFF2700 Length = 285 Score = 131 bits (330), Expect = 1e-35 Identities = 93/269 (34%), Positives = 133/269 (49%), Gaps = 18/269 (6%) Query: 11 PEPPKGE-------RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAA 63 P P GE RL NK+ L+TGA GIG A+ AFA + A + I+ + + A Sbjct: 25 PYPDCGEQSYKGSGRLANKIALITGADSGIGRAVAIAFAREGADVAIAYLDEHEDARETA 84 Query: 64 HW-RERGADVHALKADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLE-MTEED 121 W E G L D++ + ++ VE+ GRIDVLVN A + + LE +++E+ Sbjct: 85 RWVEEAGRQCLLLPGDIAQKSVCQSLVDKTVEQFGRIDVLVNNAAFQMSHETLEEISDEE 144 Query: 122 WRRCFAIDLDGAWYGCKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLT 181 W + F I++ + CKA +P M + SIIN +S +S P PY K + T Sbjct: 145 WVKTFDINITAMFRICKAAVPHM--KAGSSIINTSSVNSDMPKPTLMPYAATKGAIANFT 202 Query: 182 RALGIEYAPKGVRVNAIAPGYIETQLNVDYWNGFADPYAERQRALDLHPP-RRIGQPIEV 240 L KG+RVN++APG I T L V A E + P R GQP+EV Sbjct: 203 GGLAQLLGSKGIRVNSVAPGPIWTPLIV------ATMTDEDVKNFGSETPLGRPGQPVEV 256 Query: 241 AMTAVFLASDEAPFINASCITIDGGRSVM 269 A V LASDE +I+ S + GG+ ++ Sbjct: 257 APIYVLLASDEGSYISGSRYAVTGGKPIL 285 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 285 Length adjustment: 25 Effective length of query: 247 Effective length of database: 260 Effective search space: 64220 Effective search space used: 64220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory