GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gguA in Pseudomonas simiae WCS417

Align GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate GFF2673 PS417_13635 D-ribose transporter ATP-binding protein

Query= TCDB::O05176
         (512 letters)



>lcl|FitnessBrowser__WCS417:GFF2673 PS417_13635 D-ribose transporter
           ATP-binding protein
          Length = 510

 Score =  341 bits (875), Expect = 3e-98
 Identities = 203/500 (40%), Positives = 311/500 (62%), Gaps = 18/500 (3%)

Query: 5   ILEMRNITKTFPGVKALENVNLKVKEGEIHALVGENGAGKSTLMKVLSGVYPAGTYEGEI 64
           +LEM+ I+KTF G++ L+ V LKV  GEIHAL+GENGAGKSTLMK+LSG Y A    GEI
Sbjct: 6   LLEMQGISKTFNGLRVLKTVGLKVYPGEIHALMGENGAGKSTLMKILSGAYQADP-GGEI 64

Query: 65  HYEGAVRNFRAINDSEDIGIIIIHQELALVPLLSIAENIFLGNEVASNGVISWQQTFNRT 124
              G +        ++ +GI +I+QEL+L P LS+AENI+LG E+     I  +      
Sbjct: 65  RIAGQLIPTFDPATAKALGIAVIYQELSLCPNLSVAENIYLGRELRRGWTIDRKGMEAGC 124

Query: 125 RELLKKVGLKESPETLITDIGVGKQQLVEIAKALSKSVKLLILDEPTASLNESDSEALLN 184
            E+L+++G + +P T ++ + + ++QLVEIA+AL    K+L++DEPT  L+  +++ L  
Sbjct: 125 IEVLQRLGAEFTPATRVSSLSIAERQLVEIARALHAHAKILVMDEPTTPLSSRETDRLFA 184

Query: 185 LLMEFRNQGMTSIIITHKLNEVRKVADQITVLRDGMTVKTLDCHQEEISEDVIIRNMVGR 244
           L+ + R+QG+  I I+H++ E+  ++D+++VLRDG  +  L   ++ +S + +++ MVGR
Sbjct: 185 LIKQLRSQGLAIIYISHRMAEIYALSDRVSVLRDGHYIGELT--RDALSAEALVKMMVGR 242

Query: 245 DLEDRYPPRDVPI--GETILEVKNWNAYHQQHRDRQVLHDINVTVRKGEVVGIAGLMGAG 302
           DL   Y         G  ++ V++         D + +   +  +  GEV+GIAGL+GAG
Sbjct: 243 DLSGFYKKEHAAYNPGNVVMRVRDM-------ADGKRVRHCSFDLHAGEVLGIAGLVGAG 295

Query: 303 RTEFAMSVFGKSYGHRITGDVLIDGKPVD-VSTVRKAIDAGLAYVTEDRKHLGLVLNDNI 361
           RTE A  +F      R +G + + GK V  + T   AI AG+ Y+TEDRK  GL L+ ++
Sbjct: 296 RTELARLIFAAD--PRTSGTLEVVGKAVTPLRTPADAIRAGVVYLTEDRKAQGLFLDMSV 353

Query: 362 LHNTTL-ANLAGVSKASIIDDIKEMKVASDFRTRLRIRSSGIFQETVNLSGGNQQKVVLS 420
             N  + A +       ++D    ++ ++D    L IR +        LSGGNQQKV+L+
Sbjct: 354 ADNINVCACVPDAHAGGVLDRDHALQRSNDAIKSLSIRVASGKVNAGALSGGNQQKVLLA 413

Query: 421 KWLFSNPDVLILDEPTRGIDVGAKYEIYTIINQLAADGKGVLMISSEMPELLGNCDRIYV 480
           + L   P VLILDEPTRG+D+G+K EIY IINQLA  G G+++ISSE+PE++G CDR+ +
Sbjct: 414 RLLEVKPHVLILDEPTRGVDIGSKSEIYRIINQLAQAGIGIVVISSELPEIIGTCDRVLI 473

Query: 481 MNEGRIVAELPKGEASQESI 500
           M EG++VAE+  G AS ++I
Sbjct: 474 MREGQLVAEV--GGASGQAI 491



 Score = 65.9 bits (159), Expect = 3e-15
 Identities = 54/237 (22%), Positives = 112/237 (47%), Gaps = 25/237 (10%)

Query: 278 QVLHDINVTVRKGEVVGIAGLMGAGRTEFAMSVFGKSYGHRITGDVLIDGKPVDVSTVRK 337
           +VL  + + V  GE+  + G  GAG++   M +   +Y     G++ I G+ +       
Sbjct: 20  RVLKTVGLKVYPGEIHALMGENGAGKSTL-MKILSGAYQADPGGEIRIAGQLIPTFDPAT 78

Query: 338 AIDAGLAYVTEDRKHLGLVLNDNILHNTTLA---------NLAGVSKASIIDDIKEMKVA 388
           A   G+A + ++   L L  N ++  N  L          +  G+ +A  I+ ++  ++ 
Sbjct: 79  AKALGIAVIYQE---LSLCPNLSVAENIYLGRELRRGWTIDRKGM-EAGCIEVLQ--RLG 132

Query: 389 SDFRTRLRIRSSGIFQETVNLSGGNQQKVVLSKWLFSNPDVLILDEPTRGIDVGAKYEIY 448
           ++F    R+ S         LS   +Q V +++ L ++  +L++DEPT  +       ++
Sbjct: 133 AEFTPATRVSS---------LSIAERQLVEIARALHAHAKILVMDEPTTPLSSRETDRLF 183

Query: 449 TIINQLAADGKGVLMISSEMPELLGNCDRIYVMNEGRIVAELPKGEASQESIMRAIM 505
            +I QL + G  ++ IS  M E+    DR+ V+ +G  + EL +   S E++++ ++
Sbjct: 184 ALIKQLRSQGLAIIYISHRMAEIYALSDRVSVLRDGHYIGELTRDALSAEALVKMMV 240


Lambda     K      H
   0.316    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 611
Number of extensions: 42
Number of successful extensions: 11
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 510
Length adjustment: 35
Effective length of query: 477
Effective length of database: 475
Effective search space:   226575
Effective search space used:   226575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory