GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gguA in Pseudomonas simiae WCS417

Align GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate GFF3463 PS417_17730 ribonucleotide-diphosphate reductase subunit alpha

Query= TCDB::O05176
         (512 letters)



>lcl|FitnessBrowser__WCS417:GFF3463 PS417_17730
           ribonucleotide-diphosphate reductase subunit alpha
          Length = 502

 Score =  353 bits (906), Expect = e-102
 Identities = 200/503 (39%), Positives = 306/503 (60%), Gaps = 16/503 (3%)

Query: 3   NTILEMRNITKTFPGVKALENVNLKVKEGEIHALVGENGAGKSTLMKVLSGVYPAGTYEG 62
           +++L++ NI K +PGV+AL+++NL+V+ GEIHAL+GENGAGKSTLMK+L GV      EG
Sbjct: 2   SSLLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQD--EG 59

Query: 63  EIHYEGAVRNFRAINDSEDIGIIIIHQELALVPLLSIAENIFLGNEVASN-GVISWQQTF 121
           +I  +G  + F    D+   GI I+ QE +L+P L+  ENIFLG+E+++  G++  ++  
Sbjct: 60  QILIDGQAQQFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHELSNRFGLLRKREMV 119

Query: 122 NRTRELLKKVGLKESPETLITDIGVGKQQLVEIAKALSKSVKLLILDEPTASLNESDSEA 181
             +  L K++G+    +  +  + V +QQ VEIAKAL+   +LL+LDEPTA+L  S++E 
Sbjct: 120 EASEALFKRLGVTIDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPSEAEL 179

Query: 182 LLNLLMEFRNQGMTSIIITHKLNEVRKVADQITVLRDGMTVKTLDCHQEEISEDVIIRNM 241
           L  ++ E + QG+  I I+H L E+ +V D+I+VLRDG  V   D    +I  D ++  M
Sbjct: 180 LFEIMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDI--DHLVEMM 237

Query: 242 VGRDLEDRYPPRDV-PIGETILEVKNWNAYHQQHRDRQVLHDINVTVRKGEVVGIAGLMG 300
           VGR L   +PP+     G  +LEVK+         +R  LH       KGE++G AGL+G
Sbjct: 238 VGRRLACSFPPKPTRERGPLLLEVKDIQLVRNGPHNRFQLH-------KGEILGFAGLVG 290

Query: 301 AGRTEFAMSVFGKSYGHRITGDVLIDGKPVDVSTVRKAIDAGLAYVTEDRKHLGLVLNDN 360
           +GRTE A+ + G      ++ DV + G+ + +    +A+  G+  + E RK  GL+ + +
Sbjct: 291 SGRTELALGMMGALPS--VSKDVWLRGEKITLDDPAQALAHGIGLLPESRKSEGLITDFS 348

Query: 361 ILHNTTLANLAGVSKAS-IIDDIKEMKVASDFRTRLRIRSSGIFQETVNLSGGNQQKVVL 419
           I  N +L NL     AS +ID  +E         +L I++        NLSGGNQQKVV+
Sbjct: 349 IRENISLNNLPKYQNASGLIDKNRECASVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVI 408

Query: 420 SKWLFSNPDVLILDEPTRGIDVGAKYEIYTIINQLAADGKGVLMISSEMPELLGNCDRIY 479
           ++W+  + DVL+ DEPTRGIDVGAK +IY ++  L   G  ++MISSE+PE++G CDR+ 
Sbjct: 409 ARWINHHCDVLVFDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVA 468

Query: 480 VMNEGRIVAELPKGEASQESIMR 502
           V ++G IV  L     + + +MR
Sbjct: 469 VFHKGAIVKLLEASAVNPQEVMR 491


Lambda     K      H
   0.316    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 586
Number of extensions: 31
Number of successful extensions: 11
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 512
Length of database: 502
Length adjustment: 34
Effective length of query: 478
Effective length of database: 468
Effective search space:   223704
Effective search space used:   223704
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory