GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ytfR in Pseudomonas simiae WCS417

Align galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized)
to candidate GFF2673 PS417_13635 D-ribose transporter ATP-binding protein

Query= ecocyc::YTFR-MONOMER
         (500 letters)



>lcl|FitnessBrowser__WCS417:GFF2673 PS417_13635 D-ribose transporter
           ATP-binding protein
          Length = 510

 Score =  343 bits (880), Expect = 8e-99
 Identities = 201/488 (41%), Positives = 298/488 (61%), Gaps = 18/488 (3%)

Query: 7   QEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRG-T 65
           + +L  +G+SK F G++ L  V   +  GEI AL+GENGAGKSTL+K L+G Y AD G  
Sbjct: 4   EPLLEMQGISKTFNGLRVLKTVGLKVYPGEIHALMGENGAGKSTLMKILSGAYQADPGGE 63

Query: 66  IWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRKEMEKR 125
           I + GQ I   + A A+ LGI  +YQE++L PN+SVA+N+++GRE +R   + RK ME  
Sbjct: 64  IRIAGQLIPTFDPATAKALGIAVIYQELSLCPNLSVAENIYLGRELRRGWTIDRKGMEAG 123

Query: 126 ATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELLF 185
             E++   G        ++  S+A +Q+V I RA+   AK+L++DEPT  L ++E + LF
Sbjct: 124 CIEVLQRLGAEFTPATRVSSLSIAERQLVEIARALHAHAKILVMDEPTTPLSSRETDRLF 183

Query: 186 DLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKMMLGRE 245
            L++QLR +G+++I+++H + ++Y +SDR++VLR+G ++G      L    LVKMM+GR+
Sbjct: 184 ALIKQLRSQGLAIIYISHRMAEIYALSDRVSVLRDGHYIGELTRDALSAEALVKMMVGRD 243

Query: 246 LD-----THALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT 300
           L       HA    G  ++  + +A     GK+     FDL    GE++G+AGL+G+GRT
Sbjct: 244 LSGFYKKEHAAYNPGNVVMRVRDMAD----GKRVRHCSFDLHA--GEVLGIAGLVGAGRT 297

Query: 301 ETAEVIFGIKPADSGTALIKGKPQN-LRSPHQASVLGIGFCPEDRKTDGIIAAASVRENI 359
           E A +IF   P  SGT  + GK    LR+P  A   G+ +  EDRK  G+    SV +NI
Sbjct: 298 ELARLIFAADPRTSGTLEVVGKAVTPLRTPADAIRAGVVYLTEDRKAQGLFLDMSVADNI 357

Query: 360 ILAL---QAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRW 416
            +      A  G +  + R    + +   I+ L IR  S +     LSGGNQQKVLL+R 
Sbjct: 358 NVCACVPDAHAGGV--LDRDHALQRSNDAIKSLSIRVASGKVNAGALSGGNQQKVLLARL 415

Query: 417 LLTRPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMR 476
           L  +P  LILDEPTRG+D+G+ +EI R+I  L   G+ ++VISSEL E++G  DRV+IMR
Sbjct: 416 LEVKPHVLILDEPTRGVDIGSKSEIYRIINQLAQAGIGIVVISSELPEIIGTCDRVLIMR 475

Query: 477 DRKQVAEI 484
           + + VAE+
Sbjct: 476 EGQLVAEV 483



 Score = 88.2 bits (217), Expect = 6e-22
 Identities = 67/217 (30%), Positives = 108/217 (49%), Gaps = 9/217 (4%)

Query: 281 LEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTAL-IKGKPQNLRSPHQASVLGIGF 339
           L+V PGEI  L G  G+G++   +++ G   AD G  + I G+      P  A  LGI  
Sbjct: 27  LKVYPGEIHALMGENGAGKSTLMKILSGAYQADPGGEIRIAGQLIPTFDPATAKALGIAV 86

Query: 340 CPEDRKTDGIIAAASVRENIILALQAQRGWLRPISRKEQQEIAERFIRQLGIR-TPSTEQ 398
             ++     +    SV ENI L  + +RGW   I RK  +      +++LG   TP+T  
Sbjct: 87  IYQELS---LCPNLSVAENIYLGRELRRGWT--IDRKGMEAGCIEVLQRLGAEFTPATR- 140

Query: 399 PIEFLSGGNQQKVLLSRWLLTRPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVI 458
            +  LS   +Q V ++R L    + L++DEPT  +       +  LI+ L + GLA++ I
Sbjct: 141 -VSSLSIAERQLVEIARALHAHAKILVMDEPTTPLSSRETDRLFALIKQLRSQGLAIIYI 199

Query: 459 SSELEELVGYADRVIIMRDRKQVAEIPLAELSVPAIM 495
           S  + E+   +DRV ++RD   + E+    LS  A++
Sbjct: 200 SHRMAEIYALSDRVSVLRDGHYIGELTRDALSAEALV 236


Lambda     K      H
   0.321    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 606
Number of extensions: 32
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 500
Length of database: 510
Length adjustment: 34
Effective length of query: 466
Effective length of database: 476
Effective search space:   221816
Effective search space used:   221816
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory