Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate GFF2365 PS417_12060 sugar ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__WCS417:GFF2365 Length = 325 Score = 179 bits (453), Expect = 1e-49 Identities = 110/324 (33%), Positives = 179/324 (55%), Gaps = 14/324 (4%) Query: 7 PDTTTPKRRFRWPT---GMPQLVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRA 63 P T P+ R R G+P + LL V++ S W+ + +DIL + Sbjct: 9 PVTAAPRNRLRLSLDRFGLPLVFILLCVVMAFSSEYFMTWR----------NWMDILRQT 58 Query: 64 APVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTGILAGL 123 + +LA+GMT VI T GIDLSVG+++A AG +A + G+ L + + + G + G+ Sbjct: 59 SINGILAVGMTYVILTKGIDLSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGV 118 Query: 124 WNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVI 183 NG +VA L I PFVATL ++ RG+ ++ G +T G G + + P+I Sbjct: 119 VNGFMVANLSIPPFVATLGMLSIARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPII 178 Query: 184 IAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGII 243 I + ++FW++ R T G ++ AVG N ++A+ +G+ R ++ YV+SGL A +AG++ Sbjct: 179 IFAVVALIFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVV 238 Query: 244 VAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSG 303 ++A A AG+ ELDAI AVVIGG SL GG +++ ++ GAL+I +N G+ L G Sbjct: 239 LSARTTSA-LPQAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLG 297 Query: 304 FPPEMNQVVKAVVVLCVLIVQSQR 327 QV K ++++ +++ R Sbjct: 298 VSSYYQQVAKGLIIVFAVLIDVWR 321 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 325 Length adjustment: 28 Effective length of query: 313 Effective length of database: 297 Effective search space: 92961 Effective search space used: 92961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory