Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate GFF2324 PS417_11850 5-dehydro-2-deoxygluconokinase
Query= SwissProt::Q704D0 (325 letters) >FitnessBrowser__WCS417:GFF2324 Length = 645 Score = 119 bits (299), Expect = 2e-31 Identities = 106/352 (30%), Positives = 158/352 (44%), Gaps = 42/352 (11%) Query: 1 MAEGRCSQGKEPAEAMISLVALGEPLIQLNAVTPGP-LRYVAYFEKHVAGSEANFCIAAT 59 M + R + G++ + L+ LG + L A G L V+ F K++ GS AN Sbjct: 1 MGQTRFASGRQ-----LDLICLGRLGVDLYAQQVGARLEDVSSFAKYLGGSSANIAFGTA 55 Query: 60 MAGARCSLIARVGDDEFGRNIVEYLRGRGVDVSHVKVDPGAPTGIYFV----QRHFPVPG 115 G R ++++RVGDD GR +VE L G DVS +KVDP T + + + FP Sbjct: 56 RLGLRSAMLSRVGDDHMGRFLVESLAREGCDVSGIKVDPERLTALVLLGLKDRETFP--- 112 Query: 116 RSRLIYYRKGSAGSRVGPDDVDSSLISSADAVHSTGITLALSDSANRAVHKAFGEAKR-- 173 L++YR+ A + +D+ + I+S+ A+ TG T +D +A +A A + Sbjct: 113 ---LVFYRENCADMALRAEDISEAFIASSKALLITG-THFSTDGVYKASIQALDYAAKHN 168 Query: 174 --RTFDTNIRPALWPDLAAARRAILDVLNYGV-----------DVLVTDPDDTQILLGVR 220 R D + RP LW A V + V D++V ++ I G Sbjct: 169 VQRVLDIDYRPVLWGLAGKADGETRFVADQNVSQHVQKILPRFDLIVGTEEEFLIAGGSE 228 Query: 221 DPEEAYRKYRELGVQTLVYKLGAEGAYVFW--------NGGSYFRDALKVAVEDPTGAGD 272 D A RK REL TLV KLG +G V +G Y ++V V + GAGD Sbjct: 229 DLLTALRKVRELTQATLVVKLGPQGCTVIHGAIPARLEDGAIY--PGVRVEVLNVLGAGD 286 Query: 273 AVAGYFVALYLSGVDPRRALDLAVAASALVVGVRGDNEALPSPREAEELLKA 324 A F++ +++ R LA A LVV A+P+P E E L + Sbjct: 287 AFMSGFLSGWINDASDERCSQLANACGGLVVSRHACAPAMPTPAELEYLFNS 338 Lambda K H 0.319 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 645 Length adjustment: 33 Effective length of query: 292 Effective length of database: 612 Effective search space: 178704 Effective search space used: 178704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory