Align uronate dehydrogenase (EC 1.1.1.203) (characterized)
to candidate GFF4297 PS417_22005 epimerase
Query= BRENDA::Q88NN6 (268 letters) >FitnessBrowser__WCS417:GFF4297 Length = 245 Score = 144 bits (362), Expect = 2e-39 Identities = 89/232 (38%), Positives = 127/232 (54%), Gaps = 8/232 (3%) Query: 9 LLLTGAAGGLGKVLRERLKGYAEVLRLSDISPMAPAAGPHEEVITCDLADKAAVHTLVEG 68 +LLTGA G +GK + + I+P G + DL+DK+++ TL+EG Sbjct: 6 ILLTGACGRIGKTFFQASQDRYRFTLTDRIAPDFDLGG--HRFVHADLSDKSSLATLLEG 63 Query: 69 VDAIIHFGGVSTEHA-FEEILGPNICGVFHVYEAARKHGVKRIIFASSNHTIGFYRQDER 127 +D I+H G+ A FEE+L NI +++EAA GVKR++FASS TI Y D + Sbjct: 64 IDVIVHLSGIPHASASFEELLPNNILATTYLFEAAVAAGVKRLVFASSAQTIEGYPVDRQ 123 Query: 128 IDAHAPRRPDSYYGLSKCYGEDVASFYFDRYGIETVSIRIGS-SFPQP---QNLRMLCTW 183 I P P + YG+SKCYGE + +Y + + T+++RIG+ FP+ N R L W Sbjct: 124 ITPGMPVMPANLYGVSKCYGEALCGYYAAKTPLSTIALRIGAFEFPETHDLNNARDLSAW 183 Query: 184 LSYDDLVQLIERGLFTPGVGHTIVYGASDNRTVWWDNRHAAH-LGYVPKDSS 234 LS D VQL++R + T GV H I +G S+NR D LGY P D + Sbjct: 184 LSPRDAVQLLQRAVETEGVKHLIAHGISNNRFKRLDLSETTRVLGYQPVDDA 235 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 245 Length adjustment: 24 Effective length of query: 244 Effective length of database: 221 Effective search space: 53924 Effective search space used: 53924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory