Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate GFF2440 PS417_12445 6-phosphogluconate dehydrogenase
Query= BRENDA::G5EBD7 (332 letters) >FitnessBrowser__WCS417:GFF2440 Length = 327 Score = 427 bits (1098), Expect = e-124 Identities = 216/330 (65%), Positives = 253/330 (76%), Gaps = 7/330 (2%) Query: 1 MRIGIIGLGRMGGNIAVRLTRHGHDVVVHDRTSEVTTSVVGRCEAGRATPADTLADMAKL 60 M++GIIGLGRMGGNIA RL +GH VV+DR V G E G AD A +A L Sbjct: 1 MQLGIIGLGRMGGNIARRLMLNGHTTVVYDRNEAF---VKGLSEEGATGVADLKALVAGL 57 Query: 61 LEGDEHRVVWVMLPAGAITEDCVQQLGGLLGRGDIIIDGGNTYYKDDVRRSAELAEKGIS 120 + R VWVMLPAGA TED + +L LL GD IIDGGNT YKDDVRR+ LAEKG+ Sbjct: 58 ---QKPRTVWVMLPAGAPTEDTINELSTLLEDGDAIIDGGNTNYKDDVRRAKALAEKGLH 114 Query: 121 YVDVGTSGGVWGLERGYCMMFGGTKETAEYIDPILSALAPGIGDVPRTPGRDEAGHDPRA 180 YVDVGTSGGVWGLERGYCMM GG ET + +DPI +LAPG+G++PRT R ++ DPRA Sbjct: 115 YVDVGTSGGVWGLERGYCMMIGGDAETVQRLDPIFKSLAPGLGNIPRTKDRSDSA-DPRA 173 Query: 181 EQGYLHCGPAGSGHFVKMVHNGIEYGMMQAFAEGFDIMKSKNSPILAEKDRFELNMGDIA 240 EQGY+H GPAGSGHFVKM+HNGIEYGMMQAFAEGFDI+K+KNS L E RF+LN+ DIA Sbjct: 174 EQGYIHAGPAGSGHFVKMIHNGIEYGMMQAFAEGFDILKTKNSENLPEDQRFDLNVADIA 233 Query: 241 EVWRRGSVVSSWLLDLTAEALTRSETLNEFSGEVADSGEGRWTIEAAIEEDVPAPVMTAA 300 EVWRRGSVVSSWLLDLTA+AL L+ +SG VADSGEGRWTIEAA+E+ VP PV++ + Sbjct: 234 EVWRRGSVVSSWLLDLTADALATDPKLDGYSGSVADSGEGRWTIEAAMEQAVPVPVLSTS 293 Query: 301 LFTRFRSRSGNNFAEKILSAQRFGFGGHVE 330 LF RFRSR + + +K+LSA RFGFGGH+E Sbjct: 294 LFARFRSRQQSTYGDKMLSAMRFGFGGHLE 323 Lambda K H 0.318 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 327 Length adjustment: 28 Effective length of query: 304 Effective length of database: 299 Effective search space: 90896 Effective search space used: 90896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF2440 PS417_12445 (6-phosphogluconate dehydrogenase)
to HMM TIGR00872 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00872.hmm # target sequence database: /tmp/gapView.31442.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00872 [M=299] Accession: TIGR00872 Description: gnd_rel: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-124 399.3 0.1 5.9e-124 399.1 0.1 1.0 1 lcl|FitnessBrowser__WCS417:GFF2440 PS417_12445 6-phosphogluconate d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF2440 PS417_12445 6-phosphogluconate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 399.1 0.1 5.9e-124 5.9e-124 1 298 [. 1 326 [. 1 327 [] 0.97 Alignments for each domain: == domain 1 score: 399.1 bits; conditional E-value: 5.9e-124 TIGR00872 1 mklgliGlGrmGaniakrlakrghevvgydrdqdaveelkedraegvanlkellkrlsaprvvwvmvpag.ivda 74 m+lg+iGlGrmG nia+rl+ +gh v+ydr+++ v+ l e++a+gva+lk l+ l+ pr+vwvm+pag +++ lcl|FitnessBrowser__WCS417:GFF2440 1 MQLGIIGLGRMGGNIARRLMLNGHTTVVYDRNEAFVKGLSEEGATGVADLKALVAGLQKPRTVWVMLPAGaPTED 75 9*********************************************************************66889 PP TIGR00872 75 vleelapllekGdividgGnsyykdslrrekelkekgihlldvGtsGGvlGkerGyclmiGGdeeafkkaeplfk 149 ++el+ lle Gd +idgGn+ ykd++rr k l ekg+h++dvGtsGGv+G erGyc+miGGd e+ ++ +p+fk lcl|FitnessBrowser__WCS417:GFF2440 76 TINELSTLLEDGDAIIDGGNTNYKDDVRRAKALAEKGLHYVDVGTSGGVWGLERGYCMMIGGDAETVQRLDPIFK 150 *************************************************************************** PP TIGR00872 150 ................dva..veekGylylGeaGsGhfvkmvhnGieyGlmaalaeGlevlkns.........qf 197 d a e+Gy+++G+aGsGhfvkm+hnGieyG+m+a+aeG+++lk +f lcl|FitnessBrowser__WCS417:GFF2440 151 slapglgniprtkdrsDSAdpRAEQGYIHAGPAGSGHFVKMIHNGIEYGMMQAFAEGFDILKTKnsenlpedqRF 225 ***************9555225789************************************97778******99* PP TIGR00872 198 dfdleevarvyrrGsvirsflldltakaleesadleeveGrvedsGeGrwtvkaavdlgvpapvlatslqerfas 272 d ++ ++a+v+rrGsv+ s+lldlta al+ +++l+ +G v dsGeGrwt++aa+++ vp+pvl+tsl rf+s lcl|FitnessBrowser__WCS417:GFF2440 226 DLNVADIAEVWRRGSVVSSWLLDLTADALATDPKLDGYSGSVADSGEGRWTIEAAMEQAVPVPVLSTSLFARFRS 300 *************************************************************************** PP TIGR00872 273 rekddfankvlaalrkefGghaekkk 298 r++ ++ +k+l+a+r fGgh e k lcl|FitnessBrowser__WCS417:GFF2440 301 RQQSTYGDKMLSAMRFGFGGHLETSK 326 *********************88655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (327 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.40 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory