Align TRAP dicarboxylate transport system, periplasmic component (DctP-like) (characterized, see rationale)
to candidate GFF3394 PS417_17370 C4-dicarboxylate ABC transporter
Query= uniprot:G8AR24 (337 letters) >FitnessBrowser__WCS417:GFF3394 Length = 320 Score = 146 bits (369), Expect = 6e-40 Identities = 98/280 (35%), Positives = 157/280 (56%), Gaps = 15/280 (5%) Query: 11 TGLAAAILA-PVAASAQDIKPRLIR-FGYG-LSESSNQGRAVKFFVEDMAKRSGGKLKVK 67 T LAAA A AA A +IK I GY + N G+A + + S G+L K Sbjct: 6 TLLAAACFALSSAAHALEIKFADIHPAGYPTVVAEENMGKA-------LTQASNGELTFK 58 Query: 68 GFADASLGSDIQMQNALIGGAQEMMVGSTATLVGIVKDFAVFDLPFLFNNEQEADAVFDG 127 F LGS+ ++ GA +M S + +V D VF+LPF+F ++ V DG Sbjct: 59 YFPGGVLGSEKEVVEQAQVGAIQMTRVSLGIVGPVVPDVNVFNLPFVFRDQAHMRKVIDG 118 Query: 128 PFGQKLAAKLNDK--GLVGLVYWENGFRNLTNSKRPVEKVEDLKGIKLRVMQNPVYIDMF 185 G ++ AK+ D GLV L + + G RNL +K+PV K+EDLKG+K+RV NP++I+ F Sbjct: 119 EIGDEILAKITDSEFGLVALAWMDGGTRNLY-TKKPVRKIEDLKGMKIRVQGNPLFIEAF 177 Query: 186 NGFGANAVPLSFSELFTAMETGTVDGQENPVTTIQSSKFYEVQKYLTISKHVYSPWIVLA 245 N GAN + + E+F+A++TG +DG EN T+ ++ KY T+++H+ P ++ Sbjct: 178 NEMGANGIAMDTGEIFSALQTGVIDGAENNPPTLLEHNHFQNAKYYTLTEHLILPEPIVM 237 Query: 246 SKRWYDGLSADERKIINEAAVASRDFERK--DSREASKQS 283 SK ++ L+ ++ ++ +AA A++ ER D++ AS ++ Sbjct: 238 SKITWNKLTPAQQDMVKKAAKAAQADERVLWDAKSASSET 277 Lambda K H 0.317 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 320 Length adjustment: 28 Effective length of query: 309 Effective length of database: 292 Effective search space: 90228 Effective search space used: 90228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory