Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate GFF355 PS417_01810 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_00470 (220 letters) >FitnessBrowser__WCS417:GFF355 Length = 319 Score = 129 bits (324), Expect = 6e-35 Identities = 71/207 (34%), Positives = 119/207 (57%), Gaps = 2/207 (0%) Query: 12 WVARDTLWAGFLTSVQCSLLAIVLGTLIGLVAGLVLTYGRTWMRAPFRFYVDLIRGTPVF 71 W +W G T++ S+++ +LG +IGL GL +R YV+L+RGTP+ Sbjct: 112 WALGPLMW-GLWTTLWLSVVSGILGLIIGLATGLCRLSSNPTLRDLSTIYVELVRGTPLL 170 Query: 72 VLVLACFYMAPALGWQIGAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASQAIGLT 131 V + FY + AG+ L+LF G++VAEIVR +Q++ RGQ EA++++GL+ Sbjct: 171 VQIFI-FYFFIGTVLNLSREFAGIAALSLFTGAYVAEIVRAGVQSITRGQNEAARSLGLS 229 Query: 132 FYQSLGYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLEF 191 QS+ +V+LPQA +++LP +VK ++L+SVI + ELL S +++I +F E Sbjct: 230 ASQSMRHVVLPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVITTSFSPFEI 289 Query: 192 YLFAGFLFFIINYAIELLGRHIEKRVA 218 L+ +IN + + +E+R+A Sbjct: 290 LFCVAGLYLLINLPLSKMASRLERRLA 316 Lambda K H 0.330 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 319 Length adjustment: 25 Effective length of query: 195 Effective length of database: 294 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory