Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate GFF2379 PS417_12130 ketodeoxygluconokinase
Query= SwissProt::E0J5J4 (309 letters) >FitnessBrowser__WCS417:GFF2379 Length = 309 Score = 289 bits (739), Expect = 7e-83 Identities = 162/305 (53%), Positives = 197/305 (64%), Gaps = 7/305 (2%) Query: 1 MSKKIAVIGECMIELSEKG-ADVKRGFGGDTLNTSVYIARQVDPAALTVHYVTALGTDSF 59 +S +IA+IGECMIEL + + + FGGDTLNT+VY+ R++ +V YVTALG DSF Sbjct: 4 LSPRIALIGECMIELQHRADGSLHQSFGGDTLNTAVYLRRELGETG-SVDYVTALGDDSF 62 Query: 60 SQQMLDAWHGENVDTSLTQRMENRLPGLYYIETDSTGERTFYYWRNEAAAKFWLESEQSA 119 S M W E + QR+ RLPGLY I+TD+ GER F YWRNEAA + + + Sbjct: 63 SDAMCKQWKDEGLGLGRVQRLPGRLPGLYCIQTDANGERKFLYWRNEAAVRDCFTTPAAE 122 Query: 120 AICEELANFDYLYLSGISLAILSPTSREKLLSLLRECRANGGKVIFDNNYRPRLWASKEE 179 I L ++D +Y SGI+LA+L RE+LL L E R GGKV+FDNNYRPRLWA E Sbjct: 123 PILAALPDYDVVYFSGITLAVLGDIGRERLLQTLVETRRRGGKVVFDNNYRPRLWAGIEA 182 Query: 180 TQQVYQQMLECTDIAFLTLDDEDALWGQQPVEDVIARTHNAGVKEVVVKRGADSCLVSIA 239 + Y ++L DIA LT DDE AL+G E V A G+ EVV+KRGAD CL+ A Sbjct: 183 ARTAYHRVLAEVDIALLTEDDERALFGYADSEQVFAA--YPGIDEVVLKRGADDCLIRWA 240 Query: 240 GEGLVDVPAVKLPKEKVIDTTAAGDSFSAGYLAVRLTGGSAENAAKRGHLTASTVIQYRG 299 GE VPAVK+ EKV+DTTAAGDSFSA YLA RL G S E AA GH AS VIQ G Sbjct: 241 GERFA-VPAVKV--EKVVDTTAAGDSFSAAYLASRLKGSSPEQAALAGHRLASRVIQVPG 297 Query: 300 AIIPR 304 A+IPR Sbjct: 298 ALIPR 302 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 309 Length adjustment: 27 Effective length of query: 282 Effective length of database: 282 Effective search space: 79524 Effective search space used: 79524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory