GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagEcba in Pseudomonas simiae WCS417

Align protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized)
to candidate GFF4494 PS417_23000 PTS N-acetyl-D-glucosamine transporter

Query= BRENDA::P45604
         (651 letters)



>lcl|FitnessBrowser__WCS417:GFF4494 PS417_23000 PTS
           N-acetyl-D-glucosamine transporter
          Length = 568

 Score =  484 bits (1245), Expect = e-141
 Identities = 264/514 (51%), Positives = 347/514 (67%), Gaps = 23/514 (4%)

Query: 8   QRLGRALQLPIAVLPVAALLLRFGQPDLLNVPFIAQAGGAIFDNLALIFAIGVASSWSKD 67
           QRLGRAL LPIA+LP+A LLLR G  DLLN+  +  AG AIF NLALIFAIG+A  +++D
Sbjct: 10  QRLGRALMLPIAILPIAGLLLRLGDTDLLNIAVMHDAGQAIFANLALIFAIGIAVGFARD 69

Query: 68  NAGSAALAGAVGYFVMTKAMVTINPEINMGVLAGIITGLVAGAVYNRWAGIKLPDFLSFF 127
           N G+A LAGA+GY VM   +  ++  INMG+LAGI +GL+AG +YNR+  IKLP++L+FF
Sbjct: 70  NNGTAGLAGAIGYLVMVSTLKVMDTSINMGMLAGIASGLMAGGLYNRFKDIKLPEYLAFF 129

Query: 128 GGKRFVPIATGFFCLILAAIFGYVWPPVQHAIHSGGEWIVSAGALGSGIFGFINRLLIPT 187
           GG+RFVPI TGF  + L  IFG +WPP+QH I+S G  ++ +G+LG+ +FG  NRLLI T
Sbjct: 130 GGRRFVPIVTGFSAVGLGVIFGLIWPPIQHGINSFGVLLMESGSLGAFVFGVFNRLLIVT 189

Query: 188 GLHQVLNTIAWFQIGEFTN-AAGTVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLPGAAL 246
           GLH +LN +AWF  G FT+   G V  GD+ R++AGD   G FM+G FP+M+FGLP A L
Sbjct: 190 GLHHILNNMAWFVFGSFTDPVTGAVVTGDLTRYFAGDPKGGQFMTGMFPVMLFGLPAACL 249

Query: 247 AMYLAAPKARRPMVGGMLLSVAITAFLTGVTEPLEFLFLFLAPLLYLLHAVLTGISLFIA 306
           AMY  A   RR ++GG+ LS+A+T+FLTGVTEP+EF F+FLAP LYL+HAVLTG+S+ + 
Sbjct: 250 AMYRNALPERRKVMGGIFLSMALTSFLTGVTEPIEFAFMFLAPFLYLIHAVLTGLSMAVT 309

Query: 307 TALGIHAGFSFSAGAIDYVLMYSLPAASKNVWMLLVMGVVFFFVYFLLFSAVIRMFNLKT 366
             L IH GF+FS G ID VL +     S N W++  +G+ +  +Y+ +F+  IR FNLKT
Sbjct: 310 NMLNIHLGFTFSGGFIDMVLGW---GKSTNGWLVFPVGLAYALIYYSVFNYCIRHFNLKT 366

Query: 367 PGREDKAADVVTEEANSNTEEGLTQLATSYIAAVGGTDNLKAIDACITRLRLTVGDSAKV 426
           PGRED    VV  EA S+      Q AT+YI A+GG  NL ++ AC TRLRL + D  K 
Sbjct: 367 PGRED--TQVVQAEAMSD-----NQRATAYIQALGGAQNLLSVGACTTRLRLDMVDRNKA 419

Query: 427 NDAACKRLGASGVVKL-NKQTIQVIVGAKAESIGDEMKKVVTRGPVAAAAAAPAGNVATA 485
            DA  K LGA  VV+  N  ++QV+VG  A+SI DE+ ++   G VAAA           
Sbjct: 420 VDAELKALGAMAVVRPGNGGSLQVVVGPMADSIADEI-RLAMPGFVAAAP-------VVV 471

Query: 486 APAAKPQAVANAKTVESLVSPI--TGDVVALEQV 517
           AP  KP AV N +  E  ++ +   G+V  LE V
Sbjct: 472 APVEKPVAV-NVQEAEKWLNALGGRGNVRQLEAV 504



 Score = 51.6 bits (122), Expect = 1e-10
 Identities = 26/86 (30%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 391 QLATSYIAAVGGTDNLKAIDA-CITRLRLTVGDSAKVNDAACKRLGASGVVKLNKQTIQV 449
           Q A  ++ A+GG  N++ ++A  +TRLR+ +GD + +++A    LG  GV +L      +
Sbjct: 483 QEAEKWLNALGGRGNVRQLEAVAMTRLRVELGDDSGLSEADLTALGCQGVSQLESGVWHL 542

Query: 450 IVGAKAESIGDEMKKVVTRGPVAAAA 475
           ++G KA  +G+ ++++V    + A+A
Sbjct: 543 LIGDKATGLGEALERLVGAQQIGASA 568


Lambda     K      H
   0.323    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 948
Number of extensions: 58
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 651
Length of database: 568
Length adjustment: 37
Effective length of query: 614
Effective length of database: 531
Effective search space:   326034
Effective search space used:   326034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory