Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate GFF4322 PS417_22135 sugar ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__WCS417:GFF4322 Length = 281 Score = 135 bits (339), Expect = 1e-36 Identities = 79/266 (29%), Positives = 144/266 (54%), Gaps = 4/266 (1%) Query: 43 HGILVLWAFMVVLPLLWAVMTSFKDDASIF-GSPWSLPDKLHFDNWSRAWTEAHMGDYFL 101 + +L+L + ++PL+ ++TSFK I G+ S P + W +AW A + YF Sbjct: 18 YAVLILAVLLYLVPLVVMLLTSFKTPEDISSGNLLSWPTVVTGIGWVKAW--ATVDGYFW 75 Query: 102 NTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNN 161 N++ + +++ + +G++ YVL+ + F G++ + L + G P L+P + + Sbjct: 76 NSIKITVPAVLISTAIGALNGYVLSFWRFKGSQLFFGLLLFGCFLPFQTVLLPASFTLGK 135 Query: 162 MGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMA 221 MGL +T GL+ V++ Y L FT F ++ ++P ++ +AA +DGA F QI+LPM+ Sbjct: 136 MGLASTTTGLVFVHVVYGLAFTTLFFRNYYVSIPDALIKAARLDGAGFFTIFRQIILPMS 195 Query: 222 KPGLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVM 281 P ++ I+ F WN ++ V ++ D + +T L L + +++ A ++ Sbjct: 196 TPIIMVCLIWQFTQIWNDFLFGVVFSSG-DSQPITVALNNLVNTSTGAKEYNVDMAAAMI 254 Query: 282 AMLPVLAAYIIFQRQVVQGLTAGALK 307 A LP L Y+I + V+GLTAGA+K Sbjct: 255 AGLPTLLVYVIAGKYFVRGLTAGAVK 280 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 281 Length adjustment: 26 Effective length of query: 281 Effective length of database: 255 Effective search space: 71655 Effective search space used: 71655 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory