Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate GFF2462 PS417_12555 bifunctional glyoxylate/hydroxypyruvate reductase B
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__WCS417:GFF2462 Length = 325 Score = 314 bits (805), Expect = 2e-90 Identities = 170/318 (53%), Positives = 221/318 (69%), Gaps = 5/318 (1%) Query: 2 KKIVAWKSLPEDVLAYLQQHAQVVQVDATQHDAFVAALKDA----DGGIGSSVKITPAML 57 K +V +K L ++A L + V ++A D +A L+DA G +G+S+++ +L Sbjct: 3 KSVVLYKKLSAPLMARLHEQTDVTLIEALD-DTGLAKLRDALPGAHGLLGASLRLDAKLL 61 Query: 58 EGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVEL 117 + A +L+A++++SVG D +D+ LT RGI+L+NTPDVLTE+TADT F+LILA+ARRVVEL Sbjct: 62 DLAPQLEAVASVSVGVDNYDIDYLTARGILLSNTPDVLTETTADTGFALILATARRVVEL 121 Query: 118 AEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANP 177 A+ V+AG W +IGPA FG DV GKTLGI+G+GRIG A+A+R GF M V+Y + S P Sbjct: 122 ADMVRAGQWNKNIGPAHFGSDVHGKTLGIIGMGRIGEALAQRGHFGFGMPVIYHSHSPKP 181 Query: 178 QAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATV 237 E +GA+ L +LL ADFVCL +PLT ET+ LIGA + M I IN SRG V Sbjct: 182 AVEARFGAQYRSLNDLLQQADFVCLTLPLTAETEKLIGAEQFARMGPETIFINISRGKVV 241 Query: 238 DEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNA 297 DE AL+EALQ TI AGLDVFE EPL SPLL+L NVVA PHIGSATHETR AMA+ A Sbjct: 242 DEAALVEALQQRTIRAAGLDVFEKEPLDHSSPLLRLNNVVATPHIGSATHETREAMAKCA 301 Query: 298 AENLVAALDGTLTSNIVN 315 +NL+ AL G +N+VN Sbjct: 302 VDNLLQALAGEKPNNLVN 319 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 325 Length adjustment: 28 Effective length of query: 293 Effective length of database: 297 Effective search space: 87021 Effective search space used: 87021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory