Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate GFF3198 PS417_16375 2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__WCS417:GFF3198 Length = 329 Score = 139 bits (351), Expect = 7e-38 Identities = 104/292 (35%), Positives = 142/292 (48%), Gaps = 25/292 (8%) Query: 29 ATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVL 88 A H+ A + D S + + +G TRL AL S G++ D+A R G+ + Sbjct: 42 AEHHEVVCAFIND-----DLSAPVLEHLAKGGTRLIALR--SAGYNHVDLACAKRLGLTI 94 Query: 89 ANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVG 148 P + A+ +LILA RR+ + G + L G D+ GKT+G+VG Sbjct: 95 VRVPAYSPHAVAEHAVALILALNRRLHRAYNRTRDGDFSLH---GLTGFDLVGKTVGVVG 151 Query: 149 LGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTP 208 G+IG A+ A GF ++L + NPQ + A G R V L ELLA A + L PLT Sbjct: 152 TGQIGATFAKIMA-GFGCQLLAYDPFPNPQVQ-ALGTRYVSLPELLAQAQIISLHCPLTA 209 Query: 209 ETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETE------ 262 ++KHLI A L M+ A+LIN RG VD ALIEAL++G + GLDV+E E Sbjct: 210 DSKHLINARSLAQMQPGAMLINTGRGGLVDTPALIEALKDGQLGYLGLDVYEEEAQLFFE 269 Query: 263 -----PLPSD--SPLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 PL D + LL NV+ H T E A+A N+ A DG Sbjct: 270 DRSDLPLQDDVLARLLTFPNVIITAHQAFLTREALAAIAGTTLANIAAWADG 321 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 329 Length adjustment: 28 Effective length of query: 293 Effective length of database: 301 Effective search space: 88193 Effective search space used: 88193 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory