Align KguT (characterized, see rationale)
to candidate GFF2124 PS417_10835 major facilitator transporter
Query= uniprot:A0A167V864 (425 letters) >FitnessBrowser__WCS417:GFF2124 Length = 438 Score = 218 bits (554), Expect = 4e-61 Identities = 126/403 (31%), Positives = 195/403 (48%), Gaps = 17/403 (4%) Query: 12 WYIMPIVFITYSLAYLDRANYGFAAASGMADDLHITPALSSLLGALFFLGYFFFQVPGAI 71 W ++P++FI Y AYLDR N GFA M DL ++ A +FF+GY F++P + Sbjct: 22 WRLLPLLFIGYVFAYLDRINVGFAKLQ-MQSDLGLSDAAYGAGAGIFFVGYVLFELPSTL 80 Query: 72 YAEKRSVKKLIFVSLILWGGLATLTGMVQSVSLLIAIRFLLGVVEAAVMPAMLIYLCHWF 131 + +K L+LWG + V+ V A+RFLLGV EA P M+ YL W+ Sbjct: 81 MLPRIGARKTFSRILVLWGITSACMLFVRDVPTFYAMRFLLGVFEAGFAPGMIYYLSRWY 140 Query: 132 TRAERSRANTFLILGNPVTILWMSVVSGYLVKHF-------DWRWMFIIEGLPAVLWAFI 184 + +RA + + P+ + +S +L+ F W+WMF+IEGLP V + Sbjct: 141 GPSRMARAIAIVFIAGPMGGILGGPISAWLITTFAGVGGLAGWQWMFLIEGLPCVFLGVL 200 Query: 185 WWRLVDDRPEQASWLKAQEKTALREALAAEQQGIKPVKNYREAFRSPKVIILSLQYFCWS 244 + ++ DRP A WL A EK L L ++R R PK+ +L+ YFC Sbjct: 201 MYVVLCDRPADAPWLNAAEKQLLETELGTAS---ARSHSFRTVLRDPKLYVLASAYFCII 257 Query: 245 IGVYGFVLWLPSILKQAAALDIVTAGWLSAVPYLGAVLAMLGVSWASDRMQKRKRFVWPP 304 +Y WLP+++K D GW +A+PY+GA L M + SDR+ +R+ P Sbjct: 258 FSIYAMSFWLPAVIKALGVNDTQQLGWYAALPYVGAALGMYWIGRRSDRLGERRLHCAIP 317 Query: 305 LLIAALAFYGSYILGTEHFWWSYTLLVIAGACMYAPYGPFFAIVPELLPSNVAGGAMALI 364 A+ Y L + S LL ++ + M+ Y +A+ E + A G +ALI Sbjct: 318 AATGAVLLI-LYPLAGGNLLVSMALLTLSISMMFMAYTVLWAMPSEHIKGEAAAGGIALI 376 Query: 365 NSMGALGSFSGSWLVGYLNGVTGGPGASYL-----FMCGALLV 402 N++G G F G ++G+ TG + F+C A ++ Sbjct: 377 NTIGLSGGFWGPAMIGWAKTATGSLDTGLIAVGCVFLCAAFVI 419 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 438 Length adjustment: 32 Effective length of query: 393 Effective length of database: 406 Effective search space: 159558 Effective search space used: 159558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory