Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate GFF2912 PS417_14900 C4-dicarboxylate ABC transporter permease
Query= uniprot:Q88NP0 (426 letters) >FitnessBrowser__WCS417:GFF2912 Length = 426 Score = 318 bits (816), Expect = 2e-91 Identities = 170/420 (40%), Positives = 262/420 (62%), Gaps = 6/420 (1%) Query: 4 FILLGSFIVLILIGMPVAYALGLSALIGA-WWIDIPLQAMMIQVASGVNKFSLLAIPFFV 62 F+LL V + +G+P+A +LGLS + + + ++ I++ + ++ LAIPFF+ Sbjct: 7 FLLL---FVFMFLGVPIAISLGLSGAVSILMFSQDSVSSLAIKLFETSDAYTFLAIPFFL 63 Query: 63 LAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLI 122 L+GA M GG+++RL+ FA VG +RGGL++ ++A F A+SGSS A A+VGS+ + Sbjct: 64 LSGAFMTTGGVAQRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSIAV 123 Query: 123 PEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLL 182 M R GYP+ F + + +L PPS V+YS A S+ LFMAG++PGLLL Sbjct: 124 AGMVRSGYPKAFGAGIICNAGTLGILIPPSIVMVVYSAAT--ETSVGKLFMAGVIPGLLL 181 Query: 183 SAVMMGLCLIFAKKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGVFTATESA 242 ++M I A+ + P RE L A A WGL+ +VIILGGI SG+FT TE+A Sbjct: 182 GLMLMIAIYIVARIKKLPAQPRATFREWLTSARRAFWGLLLLVIILGGIYSGMFTPTEAA 241 Query: 243 AVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPSKI 302 AVA V+S FV +FIY+D + RD PK++ + R ++M +I A F +V+T QIP +I Sbjct: 242 AVAAVYSAFVALFIYKDMQLRDCPKVLLESGRLAIMLMFIIANAMLFAHVLTTEQIPQEI 301 Query: 303 TTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGMIM 362 T L+ L+ +N +L++ G+ M+ + ++LIL PI P+ +G+DP+H G++M Sbjct: 302 TAWVLSEGLTPIGFLIMVNVVLLIAGSFMEPSAIVLILAPIFFPIAMKLGIDPIHLGIVM 361 Query: 363 LVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLWLP 422 +VN+ IGL+ PPVG LFV SA+ +++ T++A +P+ + L + L+ VTY+P ISL LP Sbjct: 362 VVNMEIGLVHPPVGLNLFVTSAVTGLTLGQTIRAALPWLMILLVFLIMVTYLPFISLALP 421 Score = 27.3 bits (59), Expect = 0.001 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Query: 355 PVHFGMIMLVNLG-IGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTY 413 P FG ++ N G +G++ PP V+ V SA + S+ A + L L L+LM Y Sbjct: 132 PKAFGAGIICNAGTLGILIPP-SIVMVVYSAATETSVGKLFMAGVIPGLLLGLMLMIAIY 190 Query: 414 IPAISLWLPS 423 I A LP+ Sbjct: 191 IVARIKKLPA 200 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory