Align D-galacturonate dehydrogenase (EC 1.1.1.203) (characterized)
to candidate GFF453 PS417_02315 NAD-dependent dehydratase
Query= reanno::HerbieS:HSERO_RS23040 (284 letters) >FitnessBrowser__WCS417:GFF453 Length = 308 Score = 74.7 bits (182), Expect = 2e-18 Identities = 58/173 (33%), Positives = 83/173 (47%), Gaps = 6/173 (3%) Query: 17 RLLLTGAAGGVGKQLRARLASFAEVVRVADLASA--MAAVDPAAAHEEALGCDLADRAAV 74 R+L+TG AG +G L L + VRV D S + + E L D+AD V Sbjct: 4 RVLITGGAGFIGSHLVDALLAKGYGVRVLDNLSTGKRSNLPLDNPRVELLEGDVADAELV 63 Query: 75 DAMVAGCEAIIHLGGV-SVERPFEEIL---EANIKGVFHIYEAARRHGVKRVIFASSNHV 130 A++HL V SV+ ++ + ++N G ++ EA R+ GVKRV++ASS V Sbjct: 64 ARAAVDTTAVVHLAAVASVQASVDDPVSTHQSNFVGTLNVCEAMRKAGVKRVVYASSAAV 123 Query: 131 TGFYGQDERIDARDMKRPDGYYGLSKSYGEDMAQFYFDRYGVETVSIRIGSIF 183 G G+ ID K P Y K GE FY ++G+E V R +IF Sbjct: 124 YGNNGEGASIDEETTKAPLTPYASDKLAGEHYFDFYRRQHGLEPVIFRFFNIF 176 Lambda K H 0.321 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 308 Length adjustment: 26 Effective length of query: 258 Effective length of database: 282 Effective search space: 72756 Effective search space used: 72756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory