Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate GFF1095 PS417_05555 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >FitnessBrowser__WCS417:GFF1095 Length = 248 Score = 112 bits (280), Expect = 8e-30 Identities = 69/228 (30%), Positives = 120/228 (52%), Gaps = 22/228 (9%) Query: 17 INSQTWTTYILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAI 76 + S+T+ + + GL T+ AV + I+AL++G+ LG+ R RI+ +E FR + Sbjct: 16 VGSETYLDWYIAGLGWTIAIAVVAWIIALLLGSILGVMRTVPNRIVSGIATCYVELFRNV 75 Query: 77 PVLILMIFAYQMFAQYNIVPS----------------SQLAFAAVVFGLTMYNGSVIAEI 120 P+L+ Q+F Y +VP + A+ +VV L ++ + + E Sbjct: 76 PLLV------QLFIWYFLVPDMLPQNLQDWYKQDLNPTTSAYLSVVVCLGLFTAARVCEQ 129 Query: 121 LRSGIASLPKGQKEAAIALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQI 180 +R+GI +LP+GQ+ AA A+G Q W++LLPQA ++P L S+ + K+S++ I Sbjct: 130 VRTGIQALPRGQESAARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLI 189 Query: 181 GYIEVVRSGIQSASVNRNYLAALFVVALIMIVLNFSLTALASRIERQL 228 G +E++ Q+A + N A + LI LN SL L +E+++ Sbjct: 190 GLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLLMRLVEKKV 237 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 248 Length adjustment: 24 Effective length of query: 249 Effective length of database: 224 Effective search space: 55776 Effective search space used: 55776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory