Align Tonoplast intrinsic protein-a (transports water, urea, glycerol and gases (CO2 and NH3) (characterized)
to candidate GFF3160 PS417_16175 porin
Query= TCDB::Q9XG70 (247 letters) >FitnessBrowser__WCS417:GFF3160 Length = 251 Score = 91.3 bits (225), Expect = 2e-23 Identities = 69/218 (31%), Positives = 97/218 (44%), Gaps = 24/218 (11%) Query: 21 LIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFV--AMAHALVVAVTISAGFRISGGH 78 L EFI TF F G GSA+ A P + + FV ++A L V A ISGGH Sbjct: 5 LTAEFIGTFWLTFGGCGSAILAAAF---PELGIGFVGVSLAFGLTVLTMAYAVGGISGGH 61 Query: 79 LNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLTAGLETPVHTLANGVSYGQ 138 NPAVTLGL G + + Y Q+ ++ A A L + G P + + G Sbjct: 62 FNPAVTLGLWAGRRVAAGEVLPYIAAQVAGAIGASAALYLIANG--QPDFAIGGFAANGY 119 Query: 139 G------------IIMEVILTFSLLFTVYTTIVDPKKGILEGMGPLLTGLVVGANIMAGG 186 G ++ E I TF LF + G + G P+ GL + + Sbjct: 120 GPLSPGLFDMKAALLAECIATFFFLFIIMRV---TSSGAVPGFAPIAIGLALTLIHLVLI 176 Query: 187 PFSGASMNPARSFGPAFVSG--IWTDHWVYWVGPLIGG 222 P + S+NPARS GPA +G W++W+ P++GG Sbjct: 177 PVTNTSVNPARSTGPALFAGGEYLAQLWLFWLAPMVGG 214 Score = 24.6 bits (52), Expect = 0.002 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 11/97 (11%) Query: 16 DCIQALIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALVVAVTISAGFRIS 75 D AL+ E I TF F+F + + P+ + + H +++ VT ++ Sbjct: 128 DMKAALLAECIATFFFLFIIMRVTSSGAVPGFAPIAIGLALTLIHLVLIPVTNTS----- 182 Query: 76 GGHLNPAVTLG--LCMGGHITVFRSILYWIDQLLASV 110 +NPA + G L GG + + L+W+ ++ V Sbjct: 183 ---VNPARSTGPALFAGGEY-LAQLWLFWLAPMVGGV 215 Lambda K H 0.327 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 247 Length of database: 251 Length adjustment: 24 Effective length of query: 223 Effective length of database: 227 Effective search space: 50621 Effective search space used: 50621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory