Align Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 (characterized)
to candidate GFF2361 PS417_12040 dihydroxyacetone kinase
Query= SwissProt::Q4KLZ6 (578 letters) >FitnessBrowser__WCS417:GFF2361 Length = 333 Score = 179 bits (453), Expect = 2e-49 Identities = 107/326 (32%), Positives = 171/326 (52%), Gaps = 9/326 (2%) Query: 5 KMVNSVEGCAGDALAGFVACNPDLQLLQGYRVALRSDLDSLKGRVALLSGGGSGHEPAHA 64 +++N + D L G + +P+L+ + + S GRV +++GGGSGHEPA Sbjct: 3 RVINDPDQVVEDMLRGILVAHPELRQYETNPRVIVKAKPSGPGRVGIVTGGGSGHEPAFL 62 Query: 65 GFIGKGMLTGVIAGAVFASPAVGSILAAIRAVAQAGTAGTLLIVKNYTGDRLNFGLAMEQ 124 G++G G++ V G +F+SP S A RA AG + NY GD +N LAM+ Sbjct: 63 GYVGPGLVDAVAVGEIFSSPTAKSFFDAFRAADHG--AGVACLYGNYAGDNMNVKLAMKM 120 Query: 125 AKAEGISVEMVVIEDDSAFTVLKK-AGRRGLCGTILIHKVAGALAEEGMGLEEITKKVSV 183 A ++ + + VV DD A + A RRG+ G I + K+ GA A + L+ + + Sbjct: 121 AASKDMRIRTVVANDDVASAPKAEIAKRRGVAGEIFMWKIGGAAAAQHYDLDGVIRVAQK 180 Query: 184 IAKAIGTLGVSLSPCSVPGT-KPTFELAADEMELGLGIHGEAGVRRIKLVPVDQIVTLML 242 ++G+ L+PC++ KP F++ +MELG+G HGE G+ I + P + ML Sbjct: 181 TVDHCRSIGIGLTPCTIAAVGKPNFQIPDGQMELGIGHHGEPGIDVIPIEPAAAMAERML 240 Query: 243 DHMTDTSNISHVPVKSGSSVVLMVNNLGGLSFLELGIIADAAIRLLEGRGVKVARALVGT 302 + + S +SVV++V+ LG +EL I + L +G+K+ R VG Sbjct: 241 APILADRDFS-----QDNSVVVLVSGLGATPVMELYIFYAEVEKQLTAKGLKIHRCYVGN 295 Query: 303 FMSALEMRGVSLTLMLVDEPLLKLID 328 + ++LEM GV+LTL+ +D L LID Sbjct: 296 YFTSLEMMGVTLTLLGLDAELTTLID 321 Lambda K H 0.316 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 578 Length of database: 333 Length adjustment: 32 Effective length of query: 546 Effective length of database: 301 Effective search space: 164346 Effective search space used: 164346 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory