Align PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 (characterized)
to candidate GFF780 PS417_03965 PTS fructose transporter subunit IIA
Query= SwissProt::A0A0H3H456 (472 letters) >FitnessBrowser__WCS417:GFF780 Length = 952 Score = 105 bits (261), Expect = 9e-27 Identities = 99/333 (29%), Positives = 139/333 (41%), Gaps = 26/333 (7%) Query: 155 DARSVSVVIQNHNGLHVRPASKLVAALAGFNADL---VLEKGGKCVTPDSLNQIALLQVR 211 D + + + N +GLH RPA L F+ DL +++ V+ SL+++ L R Sbjct: 281 DWPAARITLANAHGLHARPAKILAQLAKSFDGDLRVRIVDGPVGAVSVKSLSKLLSLGAR 340 Query: 212 RNDTLRLLARGPDADAALAAFQALAAENFGEPTEAAPAR--RPASAD-RVEGKVVLYPQP 268 R L +A A AL A A E GE E P +P D E L Sbjct: 341 RGQVLEFIAEPSIAGDALPALLAAVEEGLGEDVEPLPTLSVQPEVLDIEPELSAPLAGSQ 400 Query: 269 QDRISRETSAAIGQQQLRLKRAIDRTLEDLSA-----------------LTTLAEATFSA 311 I+ AIG +++ + D L S + L E + S Sbjct: 401 VQAIAAAPGIAIGPAHIQVLQVFDYPLRGESCAIERERLHSALADVRRDIQGLIERSQSK 460 Query: 312 DIAAIFSGHHTLLDDPDLYAAACDIIRDEQCSAAWAWQQVLSDLSQQYRHLDDAYLQARY 371 I IF H +LDDP+L ++ + SA AW V+ ++Q L DA L R Sbjct: 461 AIREIFVTHQEMLDDPELTDEVDTRLKQGE-SAEAAWMSVIEAAAKQQESLQDALLAERA 519 Query: 372 IDIEDILHRTLRHLNERNEALPQFSAPSILVADDIFPSTVLQLNAEQVKGICLQAGSELS 431 D+ DI R L L E + S P ILV D++ PS V +L+ +V GI G + Sbjct: 520 ADLRDIGRRVLAQLCGV-ETSQEPSEPYILVMDEVGPSDVARLDPARVAGILTARGGATA 578 Query: 432 HGAIIARQAGIAMLCQQSDA-LTLQDGENVILD 463 H AI+AR GI L A L L G ++LD Sbjct: 579 HSAIVARALGIPALVGAGPAVLLLAAGTPLLLD 611 Lambda K H 0.318 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 822 Number of extensions: 46 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 952 Length adjustment: 38 Effective length of query: 434 Effective length of database: 914 Effective search space: 396676 Effective search space used: 396676 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory