GapMind for catabolism of small carbon sources

 

Aligments for a candidate for tpi in Pseudomonas simiae WCS417

Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate GFF4691 PS417_24000 triosephosphate isomerase

Query= BRENDA::P0A858
         (255 letters)



>lcl|FitnessBrowser__WCS417:GFF4691 PS417_24000 triosephosphate
           isomerase
          Length = 251

 Score =  234 bits (598), Expect = 1e-66
 Identities = 125/250 (50%), Positives = 165/250 (66%), Gaps = 2/250 (0%)

Query: 1   MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM 60
           MR  +V GNWK++G+R  V EL++ LR  LA  +G  VA+ PP ++I+      +G  I 
Sbjct: 1   MRRTMVAGNWKMHGTRASVAELINGLR-HLALPSGVDVAVFPPCLHINQVVDGLKGKSIQ 59

Query: 61  LGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQ 119
           +GAQN  +  + GA TGE S + L D G  Y+++GHSERR    E D  + +KFA  +  
Sbjct: 60  VGAQNSAVEPMQGALTGEISPSQLVDAGCSYVLVGHSERRQMMGERDGTLNRKFAAAQAC 119

Query: 120 GLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSAT 179
           GL PVLCIGET  + E+GKT EV +RQ+ ++++  G  AF  AVIAYEPVWAIGTG +AT
Sbjct: 120 GLIPVLCIGETLEQRESGKTLEVVSRQLGSIIEELGVGAFAKAVIAYEPVWAIGTGLTAT 179

Query: 180 PAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKA 239
           P QAQ VH  IR  +A  ++ +A+ V + YGGSV A+NA ELF  PDIDG L+GGASL A
Sbjct: 180 PQQAQDVHAAIRAQLAAENSEVAQGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNA 239

Query: 240 DAFAVIVKAA 249
           D F  I +AA
Sbjct: 240 DEFGAICRAA 249


Lambda     K      H
   0.316    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 177
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 255
Length of database: 251
Length adjustment: 24
Effective length of query: 231
Effective length of database: 227
Effective search space:    52437
Effective search space used:    52437
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 46 (22.3 bits)

Align candidate GFF4691 PS417_24000 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00419.hmm
# target sequence database:        /tmp/gapView.30033.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00419  [M=228]
Accession:   TIGR00419
Description: tim: triose-phosphate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    1.6e-68  217.0   0.5    1.8e-68  216.8   0.5    1.0  1  lcl|FitnessBrowser__WCS417:GFF4691  PS417_24000 triosephosphate isom


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF4691  PS417_24000 triosephosphate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.8   0.5   1.8e-68   1.8e-68       1     228 []       5     240 ..       5     240 .. 0.95

  Alignments for each domain:
  == domain 1  score: 216.8 bits;  conditional E-value: 1.8e-68
                           TIGR00419   1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdav.ksGaftGei 73 
                                         +v +n+K+++++ +v+++++ l+ ++a ++gv vav pp ++++ v+d ++   iqv+Aqn  +   +Ga tGei
  lcl|FitnessBrowser__WCS417:GFF4691   5 MVAGNWKMHGTRASVAELINGLR-HLALPSGVDVAVFPPCLHINQVVDGLKgKSIQVGAQNSAVEpMQGALTGEI 78 
                                         699******************98.69*************************999*******9987368******* PP

                           TIGR00419  74 sAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaaaA.. 146
                                         s   l+d+G+ +vl+gHsErR ++ e d  ++ k+a +++ gl +v+C+getle+re+++t+++v ++ + +   
  lcl|FitnessBrowser__WCS417:GFF4691  79 SPSQLVDAGCSYVLVGHSERRQMMGERDGTLNRKFAAAQACGLIPVLCIGETLEQRESGKTLEVVSRQLGSIIee 153
                                         *********************************************************888888887777666555 PP

                           TIGR00419 147 .....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaelaaqldvd 216
                                              + ++v+A+EPv++iGtG ++++ +a+ v++ +r  l+  + eva+ vr+lyG+sv+aa+++el+  +d+d
  lcl|FitnessBrowser__WCS417:GFF4691 154 lgvgaFAKAVIAYEPVWAIGTGLTATPQQAQDVHAAIRAQLAAENSEVAQGVRLLYGGSVKAANAVELFGMPDID 228
                                         55555********************************************************************** PP

                           TIGR00419 217 GvLlasavlkae 228
                                         G L+++a+l a+
  lcl|FitnessBrowser__WCS417:GFF4691 229 GGLIGGASLNAD 240
                                         *********997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (228 nodes)
Target sequences:                          1  (251 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 7.81
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory