Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate GFF3539 PS417_18125 polar amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >FitnessBrowser__WCS417:GFF3539 Length = 258 Score = 145 bits (365), Expect = 9e-40 Identities = 80/211 (37%), Positives = 126/211 (59%), Gaps = 13/211 (6%) Query: 16 LAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQLFIL 75 L G +T I +++LLGCV+GL + RL+ K +++ YV +RGTPLLVQ+ L Sbjct: 20 LTGLWLTCLIAVSAMLLGCVLGLAAALLRLS-KNPLLHLPVRFYVWLMRGTPLLVQIVFL 78 Query: 76 FFGLPQ-----------FGILLPAFV-CGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAA 123 + L FG+++P + +I LG+ GAY++E++R I ++DKGQ EA Sbjct: 79 YTALAAGGIFRFEDIDLFGLVVPGNIQAAIIALGLNEGAYMAEIIRAGIGAVDKGQYEAG 138 Query: 124 RSIGMSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVS 183 RS+GM MR +VLPQA ++PPLGNEF ++KN+ LVS++ + +L+ Q + S + Sbjct: 139 RSLGMGFAKLMRRIVLPQAFRVIVPPLGNEFNVMLKNTTLVSVIGVQELLLSTQMVTSAT 198 Query: 184 YRSLEVYLAIAVVYFILTGATTLVLRRIELR 214 +R E+YL +A+ + +LT R +E R Sbjct: 199 FRVFELYLVVAIYFLMLTTLWGFFQRWLEAR 229 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 258 Length adjustment: 23 Effective length of query: 199 Effective length of database: 235 Effective search space: 46765 Effective search space used: 46765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory