Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate GFF3153 PS417_16140 ABC transporter
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__WCS417:GFF3153 Length = 262 Score = 214 bits (545), Expect = 1e-60 Identities = 105/228 (46%), Positives = 151/228 (66%), Gaps = 4/228 (1%) Query: 18 GQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGA 77 GQ L+ V +V +FV +LGPSGCGKSTLLR+VAGL+ A SGR+L DG + GP Sbjct: 29 GQHLPVLERVSLDVAPGEFVALLGPSGCGKSTLLRLVAGLEPADSGRLLADGEAITGPDP 88 Query: 78 ERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLS 137 R +VFQ TL+PW + N+ GL +G+ + + + KVGL F + +P+QLS Sbjct: 89 SRVVVFQDPTLYPWRRVWDNVAVGLEAQGLLKTHAA-KVDEALEKVGLSQFARAYPRQLS 147 Query: 138 GGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDID 197 GGM QR A+ARAL N P++L++DEP G LD+ TR+ +Q+ L+ +W+ + T L VTHD++ Sbjct: 148 GGMAQRVALARALVNQPRLLILDEPLGKLDSLTRITLQKELIDLWQRQGYTALLVTHDVE 207 Query: 198 EAIFMANRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFMDLKARL 245 EA+ +ANRV VFS RP RI+ +L +D +PRH + P +DL+ ++ Sbjct: 208 EALLLANRVIVFSDRPARIQAQLTIDRAYPRH---RDDPYLVDLRRQI 252 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 262 Length adjustment: 25 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory