Align Extracellular solute-binding protein family 3; Flags: Precursor (characterized, see rationale)
to candidate GFF4245 PS417_21745 ABC transporter substrate-binding protein
Query= uniprot:B2TBJ6 (286 letters) >FitnessBrowser__WCS417:GFF4245 Length = 261 Score = 121 bits (303), Expect = 2e-32 Identities = 81/273 (29%), Positives = 133/273 (48%), Gaps = 27/273 (9%) Query: 16 VLGAAAIFAAPAQA-KDWKTVTIALEGGYAPWNLTLPGGKLGGFEPELVANLCERIKLQC 74 +LGA A+ QA + K + I +E Y P+ P G + GF+ ++ LCE +K++C Sbjct: 6 LLGALALSVLSMQAFAEGKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEEMKVKC 65 Query: 75 NLVAQDWDGMIPGLQAGKFDVLMDAISITPEREKIIAFSKPYAATPATFAVADAKVLPKA 134 V Q++DG+IP L+ K D ++ ++SIT +R+K + F+ Y TPA + + + Sbjct: 66 TWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNRYYLTPARLVLKEGTAVS-- 123 Query: 135 APGAGVVKLSGDPKADQPTVDALRKQLKGKTIGIQSGTVYTKFINDGFKDI-ATIRVYKT 193 D+L +LKGK IG+Q G+++ +F + ATI Y + Sbjct: 124 --------------------DSL-DELKGKKIGVQRGSIHDRFAKEVLAPKGATIVPYSS 162 Query: 194 SPERDLDLANGRIDASFDDVTYYAAN-IDKKETASIVMAGPKI-GGPIWGPGEGLAFRKQ 251 E LD+ GR+D + D T +D GP +G G G+A RK Sbjct: 163 QNEIYLDVEAGRLDGTVADATLLQEGFLDTPAGKGYAFTGPAFTDAKYFGDGIGIAVRKG 222 Query: 252 DADLKAKFDTAISAALADGTVKKLSNKWFKTDV 284 D + + + AI+A A+G K++ K+F D+ Sbjct: 223 DKENLDRINAAIAAIRANGKYKEIEKKYFNFDI 255 Lambda K H 0.316 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 261 Length adjustment: 25 Effective length of query: 261 Effective length of database: 236 Effective search space: 61596 Effective search space used: 61596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory