Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate GFF1262 PS417_06410 amino acid ABC transporter permease
Query= uniprot:B2TBJ7 (240 letters) >FitnessBrowser__WCS417:GFF1262 Length = 242 Score = 176 bits (445), Expect = 5e-49 Identities = 95/227 (41%), Positives = 142/227 (62%), Gaps = 4/227 (1%) Query: 3 LIQMLGFGP---EGWGGVLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGD 59 L+Q LG +G+G +LL MT+ L++ +LAV + G L A+AKLS LR+ Sbjct: 5 LLQTLGLSALSLKGFGPLLLQGTWMTIKLSVLSLAVSVLLGLLGASAKLSSLPFLRIPAQ 64 Query: 60 IYTTVFRGVPELLVIYLFYFGGSTLVTSVGQLFGAEGFVGVPPFVVGALAVGMISGAYQA 119 +YTT+ RGVP+L+++ L ++ T +T + E ++ + PF G + +G I GAY Sbjct: 65 LYTTLIRGVPDLVLMLLIFYSLQTWLTGLTDFMEWE-YIEIDPFSAGVITLGFIYGAYFT 123 Query: 120 EVYRSAVLAVSRGELEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALIS 179 E +R A+LAV RG+LEAA + G+ R + PQ++RFALPGIGN W + LK +AL+S Sbjct: 124 ETFRGAILAVPRGQLEAATAYGLKRGQRFRYVTFPQMMRFALPGIGNNWMVMLKATALVS 183 Query: 180 VTGLAELLRTSQVAAGSTHQYFTFFVVGGALYLIMTSISNRVFNRAE 226 + GLA+L++ +Q A ST+Q F F V+ +YL++TS SN V R E Sbjct: 184 IIGLADLVKAAQDAGKSTYQLFYFLVLAALIYLLITSASNFVLRRLE 230 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 242 Length adjustment: 23 Effective length of query: 217 Effective length of database: 219 Effective search space: 47523 Effective search space used: 47523 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory