Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF523 PS417_02665 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__WCS417:GFF523 Length = 425 Score = 321 bits (823), Expect = 3e-92 Identities = 198/436 (45%), Positives = 262/436 (60%), Gaps = 31/436 (7%) Query: 7 SAGKPDAGLVRKGLTEALFAAVLSFGMFVLYVGLKTDQNISNELIIVQRWGLLAIFVAVA 66 SA KP ++K + + + A ++S +F VG+ D N +A+ VA+ Sbjct: 2 SAAKPID--IKKSVVDTVLAGLISLVVFGPIVGVVLDGYSFN-----LEPARVALLVAIV 54 Query: 67 AIGRFAMVVFIRPNIDRRKLSKAREGELDISTEKSFFHRHFLKIALIALLLYPMVVVAIK 126 +GRFAM +F++ K K +G + + + + ++ ++V+AI Sbjct: 55 MVGRFAMSLFLQTP----KGVKILQGFESTGSGVHVLAPDYK--SRLRWIIPALIVIAIV 108 Query: 127 GPQGSLTYVDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGL 186 P + Y+ I LIYV+L GLNIVVGLAGLLDLGYVAFYA+GAY AL Y GL Sbjct: 109 FPIFANKYLLTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGL 168 Query: 187 SFWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGI 246 FW +LPL+ I AAL G ILGFPVLR+ GDYLAIVTL FGEIIRLVL NW T G G+ Sbjct: 169 GFWTVLPLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSFTGGPNGM 228 Query: 247 SSIPKATLFGIPFDATA--GG--FAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLR 302 +P T G+ F A GG F + F + + +F++ ++ + + Y+ RL Sbjct: 229 -PVPSPTFLGLEFGKRAKDGGIPFHEFFGIDYNPNIKFLFIYIVLFLVVLAVLYIKHRLT 287 Query: 303 RMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFV 362 RMP+GRAWEALREDEIACRS+G+N V KL+AF GA AG AG FFA+ QGFV+P SF Sbjct: 288 RMPVGRAWEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFASYQGFVNPSSFT 347 Query: 363 FLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFTPELYRMLIF 422 F ESA+ILAIVVLGGMGS G+ IAA V+ ELLR S YR+L+F Sbjct: 348 FFESALILAIVVLGGMGSTVGVVIAAFVLTVAPELLRSFS-------------EYRVLLF 394 Query: 423 GLAMVVVMLFKPRGFV 438 G+ MVV+M+++PRG + Sbjct: 395 GVLMVVMMIWRPRGLI 410 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 643 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 425 Length adjustment: 32 Effective length of query: 431 Effective length of database: 393 Effective search space: 169383 Effective search space used: 169383 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory