Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF1299 PS417_06600 leucine/isoleucine/valine transporter ATP-binding subunit
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__WCS417:GFF1299 Length = 255 Score = 254 bits (649), Expect = 1e-72 Identities = 129/258 (50%), Positives = 176/258 (68%), Gaps = 9/258 (3%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 +LKVE+LSM+FGGL+A+N + K + ALIGPNGAGKTTVFNC+TGFYKP+ G I Sbjct: 5 ILKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYKPSGGSILL 64 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 + + ++ L I ++ V RTFQN+RLF +T +ENLL+AQH L + Sbjct: 65 DGQP-----IQGLAGHEIARKG-VVRTFQNVRLFKDMTAVENLLIAQHRHL---NTNFFA 115 Query: 134 GLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELL 193 GL +++ EA+E A +WL+K +L + A+ PAG L YG QRRLEIAR M T P +L Sbjct: 116 GLFKTPAFRKSEREAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRIL 175 Query: 194 CLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISD 253 LDEPAAGLNP+E+ L AL+ +R E ++LLIEHDM +VM ISDH+VV+ G +++ Sbjct: 176 MLDEPAAGLNPKETEDLKALISVLREENNATVLLIEHDMKLVMSISDHIVVINQGTPLAN 235 Query: 254 GTPDHVKNDPRVIAAYLG 271 GTP+ ++++P VI AYLG Sbjct: 236 GTPEQIRDNPEVIKAYLG 253 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 255 Length adjustment: 25 Effective length of query: 267 Effective length of database: 230 Effective search space: 61410 Effective search space used: 61410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory