Align Histidine transport system permease protein HisQ (characterized)
to candidate GFF3437 PS417_17595 amino acid ABC transporter permease
Query= SwissProt::P52094 (228 letters) >FitnessBrowser__WCS417:GFF3437 Length = 233 Score = 256 bits (655), Expect = 2e-73 Identities = 128/223 (57%), Positives = 169/223 (75%) Query: 2 LYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVPD 61 L+G+ ++ QGA +TL+LA ++ L++ +GLI A KLS + + YTTLIR VPD Sbjct: 7 LHGYGPMLAQGAWMTLKLAFLALALSLALGLIAAAAKLSSAKWLRVPATLYTTLIRSVPD 66 Query: 62 LVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPK 121 LVL+LLIFY LQ+ LN ++E G +IDP AG+ITLGFIYGAYFTE FRGA ++VP Sbjct: 67 LVLILLIFYSLQLWLNDLSEVFGWDYFEIDPFTAGVITLGFIYGAYFTENFRGAILSVPV 126 Query: 122 GHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQ 181 G +EAATA+G +R Q F ++FP +MR+ALPG+GNNW V+LKSTALVS++GL D+VKA Q Sbjct: 127 GQLEAATAYGLSRWQRFHLVLFPQLMRFALPGLGNNWLVLLKSTALVSIIGLSDLVKAAQ 186 Query: 182 LAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVK 224 AGK+T EP YF I+ G++YLV TT+SN VL LERRY++G+K Sbjct: 187 NAGKTTNEPLYFLILAGLMYLVITTLSNRVLKRLERRYNLGIK 229 Lambda K H 0.328 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 233 Length adjustment: 23 Effective length of query: 205 Effective length of database: 210 Effective search space: 43050 Effective search space used: 43050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory