Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate GFF789 PS417_04010 glycine/betaine ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__WCS417:GFF789 Length = 385 Score = 204 bits (519), Expect = 2e-57 Identities = 103/227 (45%), Positives = 152/227 (66%), Gaps = 6/227 (2%) Query: 45 VVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDAL 104 V VND+SL++ GEI V +G SG GKST ++ NRLI PTSG IL++GED LD L Sbjct: 18 VTAVNDVSLTVNEGEICVFLGPSGCGKSTTLKMINRLIKPTSGKILINGEDTTDLDEVTL 77 Query: 105 REFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGL--KGYE 162 R I V Q GL P+ ++ +N+ K+ G KQ C +RA ++ + L K Y Sbjct: 78 RR----NIGYVIQQIGLFPNMTIEENIVVVPKLLGWDKQKCHDRARELMSMIKLEPKQYL 133 Query: 163 NKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTI 222 ++YP +LSGG +QR+G+ RALAAD ++LMDE F A+DP+ R +Q++ E+Q+ L+KT+ Sbjct: 134 HRYPRELSGGQQQRIGVIRALAADAPLLLMDEPFGAVDPINREMIQNEFFEMQRALNKTV 193 Query: 223 VFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 + ++HD+DEA+++G++IAI + GKL+Q+ P +L PADE+V FV Sbjct: 194 IMVSHDIDEAIKLGDKIAIFRAGKLLQIDHPDTLLAHPADEFVSNFV 240 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 385 Length adjustment: 28 Effective length of query: 248 Effective length of database: 357 Effective search space: 88536 Effective search space used: 88536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory