Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate GFF2307 PS417_11765 ABC transporter substrate-binding protein
Query= metacyc::MONOMER-11683 (330 letters) >FitnessBrowser__WCS417:GFF2307 Length = 325 Score = 150 bits (378), Expect = 5e-41 Identities = 102/320 (31%), Positives = 163/320 (50%), Gaps = 5/320 (1%) Query: 11 LTDQEAVDMYRTMLLARKIDERMWLLNRSGKIP-FVISCQGQEAAQVGAAFALDREMDYV 69 L+ + + Y M R +ER+ + +G+IP FV GQEA+ G L+ E D + Sbjct: 5 LSTDQLLHAYTVMRTIRDFEERLHVEFATGEIPGFVHLYAGQEASAAGVMAHLNDE-DCI 63 Query: 70 LPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGGRQMPGHFGQKKNRIVTGSSPVTTQV 129 +R G +A G+ +M + K GG+ H ++ ++ + V Sbjct: 64 ASNHRGHGHCIAKGVDVFGMMAEIYGKKTGV-CGGKGGSMHIADQEKGMLGANGIVGAGA 122 Query: 130 PHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAISV 189 P A G ALA +++ A FG+G SN+G E N A++ KLP +F+ ENN YA + Sbjct: 123 PLAAGAALASKLKGSQGVAVAFFGDGGSNEGAVFEAMNLASIMKLPCLFVAENNGYAEAT 182 Query: 190 PYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYRL 249 VAC++I++RA+G+GMPGV V+GND V+ A+ A ERAR+G+GPTL+E R Sbjct: 183 GSGWSVACKDIAERAVGFGMPGVIVDGNDFFAVHAALGVAVERARKGDGPTLVEVKLSRF 242 Query: 250 TPHSSDDDDSSYRGREEVEEAKK-SDPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVNEA 308 H + D +YRG +EV+ ++ +D L ++ G L + + E+ ++ +A Sbjct: 243 YGH-FEGDAQTYRGPDEVKNLRENADCLALFRQRCSAEGWLDAAQFERIDGEVAQLIEDA 301 Query: 309 TDEAENAPYAAPESALDYVY 328 A++ P L VY Sbjct: 302 VRLAKSDPKPQAADLLSDVY 321 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 325 Length adjustment: 28 Effective length of query: 302 Effective length of database: 297 Effective search space: 89694 Effective search space used: 89694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory