Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate GFF2094 PS417_10680 enoyl-CoA hydratase
Query= curated2:P24162 (257 letters) >FitnessBrowser__WCS417:GFF2094 Length = 263 Score = 155 bits (392), Expect = 8e-43 Identities = 98/254 (38%), Positives = 133/254 (52%), Gaps = 5/254 (1%) Query: 9 EISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGE--ARAIVLTGSGRAFCSGQDLG 66 ++ G+A ITL+R NAL+ L A L + R +VLTG+GR+FC+G DL Sbjct: 10 QVQAGVAWITLNRGPQRNALDIPTLKHLHALLDTFNTDPAVRVVVLTGNGRSFCAGADLA 69 Query: 67 DGAAEGLN--LETV-LREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVVIAAQ 123 + AA LET + L+ +++ P +AA+NG A GAG +L L D+ +AAQ Sbjct: 70 EWAAAEARGALETYGWTDTAHALMTRLHTLDKPTIAAINGTAVGAGMDLTLCCDLRVAAQ 129 Query: 124 SAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEAVPDV 183 SA F +T + PDAG +W LPR +G +A + E A+ A GL+ E V D Sbjct: 130 SARFKAGYTSMAYSPDAGASWHLPRLIGSEQAKRLLFLDELWSADRALAAGLVGEVVTDD 189 Query: 184 DFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADFREGV 243 H A A LA GP+ AFA K G LPAQL E G+SAD E + Sbjct: 190 HLHAHTNALATRLANGPTFAFAQTKTLIRDGAERSLPAQLQAELAAGLLCGRSADGTEAL 249 Query: 244 QAFLEKRPPHFTGR 257 +A LEKR P F+G+ Sbjct: 250 RASLEKRLPIFSGK 263 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 263 Length adjustment: 24 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory