GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA in Pseudomonas simiae WCS417

Align Propionyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.3) (characterized)
to candidate GFF3827 PS417_19595 3-methylcrotonyl-CoA carboxylase

Query= reanno::PS:Dsui_0516
         (663 letters)



>lcl|FitnessBrowser__WCS417:GFF3827 PS417_19595 3-methylcrotonyl-CoA
           carboxylase
          Length = 627

 Score =  493 bits (1270), Expect = e-144
 Identities = 287/660 (43%), Positives = 397/660 (60%), Gaps = 38/660 (5%)

Query: 2   FKKILIANRGEIACRVIKTARKMGIKTVAVYSEADKDALFVEMADEAVCIGPAASKESYL 61
           F KILIANRGEIACR+ +TA+ +G +TVAVYS+AD  AL V+MADEAV IGPA  ++SYL
Sbjct: 4   FSKILIANRGEIACRIQRTAQALGYRTVAVYSDADAQALHVQMADEAVHIGPAPVQQSYL 63

Query: 62  VADKIIAACKQTGAEAVHPGYGFLSENAEFSRRLEEEGIKFIGPKHYSIAKMGDKIESKK 121
             D I+ A + T A+A+ PGYGFLSEN +F+R  ++ G+ FIGP   +I  MG K  SK 
Sbjct: 64  NIDAILNAARVTSADAIPPGYGFLSENPDFARACQQAGLTFIGPSPEAIELMGSKRLSKL 123

Query: 122 LAIEAKVNTIPGYNDAIDGPDAAVEIAKKIGYPVMIKASAGGGGKGLRVAYNDAEAHEGF 181
             ++A V  I GY  +          A  IGYP+MIKASAGGGG+G+R+  +  E  +  
Sbjct: 124 AMLDAGVPCIAGYQGSAQDDSTLQREADAIGYPLMIKASAGGGGRGMRLVQHPEELLDNL 183

Query: 182 SSCVNEARNSFGDDRVFIEKYVLEPRHIEIQVLGDSHGNYVYLNERDCSIQRRHQKVIEE 241
            +  +EA+N+FG   + +E+ +++PRH+EIQ+ GDSHG+ +YL ERDCSIQRRHQK+IEE
Sbjct: 184 HTARSEAKNAFGSGELILEQALIDPRHVEIQLFGDSHGHLIYLGERDCSIQRRHQKIIEE 243

Query: 242 APSPFVDPEMRKAMGEQAVALARAVNYESAGTVEFVVSGATKEFYFLEMNTRLQVEHPVT 301
           AP P + PE+R+AMGE A+   RAVNY  AGTVEF++      FYFLEMNTRLQVEHPVT
Sbjct: 244 APCPVMTPELRQAMGEAALNAGRAVNYVGAGTVEFLLD-RNGRFYFLEMNTRLQVEHPVT 302

Query: 302 ELITGLDLVEQMIRVAYGEKLPLTQADVQINGWAMECRINAEDPFRGFLPSTGRLVKFQP 361
           ELITGLDLV+  +++A G+ LPLTQ DV +NG AME R+ AEDP +GFLP TG ++++ P
Sbjct: 303 ELITGLDLVDWQLQIAAGQPLPLTQPDVSLNGHAMEVRLYAEDPAQGFLPQTGEVLRWDP 362

Query: 362 PAEVDGQVRVDTGVYDGGEISMYYDSMIAKLIVHGASREQAIARMRDALNGFVIRGISSN 421
            A     VR+D GV +G  IS +YD M+ K+I +GA+RE+A  ++  A+   V+ G+++N
Sbjct: 363 AA----GVRIDHGVTEGQRISPFYDPMLGKIIAYGATREEARRKLLRAVEDTVLLGVTTN 418

Query: 422 IPFQAALMQHARFQSGIFDTGFIAKEYPKGFDASMVPHDDPALLIGVAAFVHRRYIDRAA 481
            P    L++H  F  G F TGFIA+ +     + + P    A  + +AA +   Y   A 
Sbjct: 419 QPLLVDLLKHPDFVGGDFSTGFIAEHF-----SEIRPLTPSAEHLALAAALF--YQHSAN 471

Query: 482 QVSGQLPGHERKVGDEWVVIRNGERHPVVAKPIEGGYLVTYNGEKYELLSDWRQGQSLFN 541
           Q    L G        W   RN    P   +    G   T N     L +D R    +FN
Sbjct: 472 QHPQGLAG--------W---RNNTSAPCTYRLEVNGDTHTVNAAPLPLTTDGRHANHVFN 520

Query: 542 GTCNGEEFTLQVERHRMTYQLFHWGTRADMMVMSARAAELLALMPEKAAPDLSKFLLSPM 601
           G            R R  Y L         + ++ R  ++ +    + A   S  + +PM
Sbjct: 521 GI-----------RRRTAYHLVGNQLWLPGLTVTDRTQQVAS----RQANVSSGTVKAPM 565

Query: 602 PGLLREVSVAVGQEVKAGEKLAVIEAMKMENILKAEQDCKVKKISVTAGSSLSVDEIIIE 661
            G + +V V+ G  V  G+ L V+EAMKME+ L A  D  +K + V AG  +   ++++E
Sbjct: 566 DGAIVDVRVSAGDSVTKGQLLLVLEAMKMEHPLTAGIDGVIKGVQVIAGDQVRNRQVLLE 625


Lambda     K      H
   0.319    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 995
Number of extensions: 44
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 663
Length of database: 627
Length adjustment: 38
Effective length of query: 625
Effective length of database: 589
Effective search space:   368125
Effective search space used:   368125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory