GapMind for catabolism of small carbon sources

 

Aligments for a candidate for galE in Pseudomonas simiae WCS417

Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate GFF453 PS417_02315 NAD-dependent dehydratase

Query= BRENDA::F6DEY6
         (311 letters)



>lcl|FitnessBrowser__WCS417:GFF453 PS417_02315 NAD-dependent
           dehydratase
          Length = 308

 Score =  209 bits (532), Expect = 7e-59
 Identities = 125/293 (42%), Positives = 177/293 (60%), Gaps = 15/293 (5%)

Query: 2   RVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKRENVPKGVP---FFQVDLRDKEEV 58
           RVL+TGGAGFIGSH+V+ LLA+G  V VLDNL+TGKR N+P   P     + D+ D E V
Sbjct: 4   RVLITGGAGFIGSHLVDALLAKGYGVRVLDNLSTGKRSNLPLDNPRVELLEGDVADAELV 63

Query: 59  ERAFREFRPTHVSHQAAQASVKVSVEDPVLDFEVNLLGGLNLLEACRQYGVEKLVFASTG 118
            RA  +   T V H AA ASV+ SV+DPV   + N +G LN+ EA R+ GV+++V+AS+ 
Sbjct: 64  ARAAVD--TTAVVHLAAVASVQASVDDPVSTHQSNFVGTLNVCEAMRKAGVKRVVYASS- 120

Query: 119 GAIYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQSYGLKWVSLRYGNVYGPRQ 178
            A+YG   EG   +E     P +PYA+ K A EHY   Y + +GL+ V  R+ N++GPRQ
Sbjct: 121 AAVYGNNGEGASIDEETTKAPLTPYASDKLAGEHYFDFYRRQHGLEPVIFRFFNIFGPRQ 180

Query: 179 DPHGE-AGVVAIFAERVLNGLPVTLYARKTPGDEGCVRDYVYVGDVAEAHALALFSLE-- 235
           DP    +GV++IF+ER   G+P+ ++     GD    RD++YV D+ +    A+ +    
Sbjct: 181 DPSSPYSGVISIFSERAQQGVPIAVF-----GDGEQTRDFMYVEDLVDVLVQAIEAPSAP 235

Query: 236 -GIYNVGTGEGHTTREVLEAVAEAAGKAPQVQPAPPRPGDLERSVLSPLKLMA 287
            G  NVG     T ++VL+A+ E  GK P V   P R GD+  S  +  +L+A
Sbjct: 236 LGAINVGWNRTTTLKQVLQALEEIVGKLPTVTYGPARSGDIRHSRANNQRLLA 288


Lambda     K      H
   0.318    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 287
Number of extensions: 18
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 311
Length of database: 308
Length adjustment: 27
Effective length of query: 284
Effective length of database: 281
Effective search space:    79804
Effective search space used:    79804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory