Align galactaro-1,5-lactonase (characterized)
to candidate GFF1427 PS417_07255 calcium-binding protein
Query= reanno::WCS417:GFF3393 (291 letters) >FitnessBrowser__WCS417:GFF1427 Length = 292 Score = 169 bits (429), Expect = 5e-47 Identities = 109/297 (36%), Positives = 154/297 (51%), Gaps = 15/297 (5%) Query: 1 MNAELIVDARNAVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIA- 59 M E++VD + +GE PVW + LYW+D G + R + + AW Q + +A Sbjct: 1 MRIEVLVDVKTTLGEGPVWDVEQQRLYWIDSADGRILRCTDDGRELRAWEVGQKIGSMAL 60 Query: 60 RTDAGNWVAGMETGFFQLTPHNDGSLDTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMV 119 R D + + ++ G L + + L+A E D RLNDG+ DRQGRF GSM Sbjct: 61 RQDGESAIVALQNGVHTLDLKSG---ELNLIADPEPHLPDNRLNDGKVDRQGRFIFGSM- 116 Query: 120 LNMGLNAAEGTLYRYTSGAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFDY 179 + + A LYR + + H +G I NG +SP G T Y D+ +IWA+DY Sbjct: 117 -DTQEDNASAKLYRLDADLSLHTLDEGIIVSNGPCWSPSGDTFYFCDTWS--GEIWAYDY 173 Query: 180 DIDTGTPSNRRVFVDMH-KHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTV 238 D+ TG SNRR F + + G DG VDA+GC W AG + R++P+G +DR + + Sbjct: 174 DLATGNVSNRRTFAKVDTRGGGAADGCTVDAEGCLWQALVYAGKLVRYTPEGVVDRIIQM 233 Query: 239 PVKKPTMCAFGGSRLDTLFVTSIRDD-----QSEQSLSGGVFALNP-GVVGLPEPTF 289 PVKK T FGG LDTLFVTS+ ++ G +FA+ GV G+ E F Sbjct: 234 PVKKVTSLTFGGPNLDTLFVTSMAKPPLPRFPADGQQRGALFAITGLGVQGIAERRF 290 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 292 Length adjustment: 26 Effective length of query: 265 Effective length of database: 266 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory