GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacZ in Pseudomonas simiae WCS417

Align Exo-alpha-(1->6)-L-arabinopyranosidase; APY; Beta-D-galactopyranosidase; EC 3.2.1.- (characterized)
to candidate GFF1345 PS417_06840 beta-D-glucoside glucohydrolase

Query= SwissProt::E7CY69
         (757 letters)



>lcl|FitnessBrowser__WCS417:GFF1345 PS417_06840 beta-D-glucoside
           glucohydrolase
          Length = 763

 Score =  248 bits (633), Expect = 8e-70
 Identities = 200/666 (30%), Positives = 310/666 (46%), Gaps = 93/666 (13%)

Query: 69  TCFPPAAGLSSSWNPELIHKVGEAMAEECIQEKVAVILGPGVNIKRNPLGGRCFEYWSED 128
           T FP +  L+SSW+ + I + G   A+E   + + +   P V+I R+P  GR  E + ED
Sbjct: 113 TIFPISLALASSWDMDAIGRSGRIAAQEAAADSLDITFAPMVDISRDPRWGRTSEGFGED 172

Query: 129 PYLAGHEAIGIVEGVQ------SKGVGTSLKHFAANNQ-ETDRLRVDARISPRALREIYF 181
            YL    A  +V+  Q      +  +  S+KHFA     E  R      +SP  + + Y 
Sbjct: 173 TYLVSRIAEVMVKAFQGVSPANADSIMASVKHFALYGAVEGGRDYNVVDMSPVKMYQDYL 232

Query: 182 PAFEHIVKKAQPWTIMCSYNRINGVHSAQNHWLLTDVLRDEWGFDGIVMSDWGA------ 235
           P + H   KA    +M + N INGV +  N WL+ D+LR +WGF G+ +SD GA      
Sbjct: 233 PPY-HAAIKAGSGGVMVALNSINGVPATANTWLMNDLLRKDWGFKGLAVSDHGAIFELIK 291

Query: 236 -----DHDRGASL--NAGLNLEMPPSYTDDQIVYAVRDGLITPAQLDRMAQGMIDLVNKT 288
                D    A L   AG+++ M  S    ++   ++ G I  + +D   + ++    K 
Sbjct: 292 HGVAKDGREAAKLAIKAGIDMSMNDSLYGKELPGLLKSGEIEQSDIDNAVREVLGA--KY 349

Query: 289 RAAMSIDNYRFDVDAHDEVA--------HQA-----AIESIVMLKNDDAILPLNAGPVAN 335
              +  D Y     A D+ A        H+A     A  S+V+LKN +  LPL       
Sbjct: 350 DMGLFKDPYLRIGKAEDDPADTYAESRLHRAEARDIARRSLVLLKNQNNTLPLKK----- 404

Query: 336 PSATPQKIAVIGEFARTP-RYQGGGSSHITPTKMTSFLDTL----AERGIKADFAPGFTL 390
            SAT   IA++G  A+ P    G  ++   P +  + LD L     E+G K  +A G  +
Sbjct: 405 -SAT---IALVGPLAKAPIDMMGSWAAAGKPEQSVTLLDGLNAVIGEKG-KIIYARGANI 459

Query: 391 ----------------------DLEPADPALESEAVETAKNADVVLMFLGLPEAVESEGF 428
                                 D  PA   ++ EAV+ AK ADVV+  +G    +  E  
Sbjct: 460 TQDKAVVDYLNFLNFDAPEVVDDTRPAQVMID-EAVKAAKEADVVVAAVGESRGMSHESS 518

Query: 429 DRDTLDMPAKQIALLEQVAAANQNVVVVLSNGSVITVAPWAKNAKGILESWLLGQSGGPA 488
            R  L++P  Q  L++ + A  + +V+VL NG  +++    + A  ILE+W  G  GG A
Sbjct: 519 SRTDLNIPQSQRDLIKALKATGKPLVLVLMNGRPLSILEENQQADAILETWFAGTEGGNA 578

Query: 489 LADVIFGQVSPSGKLAQSIPLDINDDPSMLNWPGEEGHVDYGE-------GVFAGYRYYD 541
           +ADV+FG  +PSGKL  + P  +   P+  N      H+  G        G +    + D
Sbjct: 579 IADVLFGDYNPSGKLPITFPRSVGQIPTYYN------HLTIGRPFTPGKPGNYTSQYFDD 632

Query: 542 TYGKAVDYPFGYGLSYATFEITGVAVAKTGANTA---TVTATVTNTSDVDAAETVQVYVV 598
           T G    +PFGYGLSY TF ++ +A++ T  N       + TV NT  VD    VQ+Y+ 
Sbjct: 633 TTGPL--FPFGYGLSYTTFSLSDMALSSTTLNKTGKLDASVTVKNTGKVDGETVVQLYIQ 690

Query: 599 PGKADVARPKHELKGFTKAFLKAGESKTVAIDLDERAFAYWSEKYNDWHVEAGEYAIEVG 658
                + RP  ELK F K  LKAGE +T+   + E    +++ +   +  E GE+ +++G
Sbjct: 691 DVAGSMIRPIKELKNFQKVMLKAGEERTLHFTITEEDLKFYNTQLK-FAAEPGEFNVQIG 749

Query: 659 VSSRDI 664
           + S+D+
Sbjct: 750 LDSQDV 755


Lambda     K      H
   0.315    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1293
Number of extensions: 66
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 757
Length of database: 763
Length adjustment: 40
Effective length of query: 717
Effective length of database: 723
Effective search space:   518391
Effective search space used:   518391
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory