Align glucose transporter, periplasmic substrate-binding component (characterized)
to candidate GFF2145 PS417_10940 sugar ABC transporter substrate-binding protein
Query= reanno::Phaeo:GFF3639 (341 letters) >FitnessBrowser__WCS417:GFF2145 Length = 333 Score = 227 bits (579), Expect = 3e-64 Identities = 129/324 (39%), Positives = 191/324 (58%), Gaps = 6/324 (1%) Query: 8 SALAFAATASMAFAEDVTVGVSWSNFQEERWKTDEAAIKAALEAKGATYVSADAQSSSAK 67 +ALA A +MA + +G S + + ERW D AA E A A ++ K Sbjct: 11 TALALLALPAMADSAHPKIGFSIDDLRLERWSRDRDYFVAAAEKLDAKVFVQSADANEQK 70 Query: 68 QLSDIESLIAQGVDALIVLAQDAQAIGPAVQAAADEGIPVVAYDRLIEDGRA-FYLTFDN 126 Q+S IE+LI++GVD ++++ +A + AV A GI VV+YDRLI + Y++FDN Sbjct: 71 QISQIENLISRGVDVIVIVPFNATVLTNAVAEAKKAGIKVVSYDRLILNADIDAYISFDN 130 Query: 127 VEVGRMQARAVLEAQPSGNYVMIKGSPTDPNADFLRGGQQEIIQAAIDSGDIKIVGEAYT 186 +VG MQA VL+A P GNY ++ G+PTD NA LR GQ +++Q AID GDIK+VG+ + Sbjct: 131 EKVGEMQASGVLQAAPKGNYFLLGGAPTDNNAKVLREGQMKVLQPAIDKGDIKVVGQQWV 190 Query: 187 DGWLPANAQRNMEQILTANDNKVDAVVASNDGTAGGVVAALTAQGMEG-IAVSGQDGDHA 245 W P A +E LT N+NK+DA+VASND TAGG + AL AQ + G + +SGQD D A Sbjct: 191 KEWNPTEALSIVENALTRNNNKIDAIVASNDATAGGAIQALAAQKLAGKVPISGQDADLA 250 Query: 246 ALNRVAKGTQTVSVWKDARDLGKAAANIAVEMAEGAVMGDVAGGAAWTSPAGTELTARFL 305 A+ RV GTQT++V+K + + AA ++V++A + ++ ++ L Sbjct: 251 AIKRVIDGTQTMTVYKPLKLIASEAAKLSVQLAR----NEKPTYSSQYDNGSKKVDTILL 306 Query: 306 EPIPVTADNLSVVVDAGWITKEAL 329 P P+T N+ ++ G+ TKE + Sbjct: 307 TPTPLTKANIDLLEKDGFYTKEQI 330 Lambda K H 0.313 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 333 Length adjustment: 28 Effective length of query: 313 Effective length of database: 305 Effective search space: 95465 Effective search space used: 95465 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory