Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate GFF3433 PS417_17565 branched-chain amino acid aminotransferase
Query= reanno::pseudo5_N2C3_1:AO356_22970 (339 letters) >lcl|FitnessBrowser__WCS417:GFF3433 PS417_17565 branched-chain amino acid aminotransferase Length = 339 Score = 631 bits (1628), Expect = 0.0 Identities = 302/339 (89%), Positives = 319/339 (94%) Query: 1 MGNESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLTDDNVLHISEGSTALHYGQQCFEG 60 MGNESINWDKLGFDYIKTDKR+L W++G W AGTLTDDNVLHISEGSTALHYGQQCFEG Sbjct: 1 MGNESINWDKLGFDYIKTDKRFLQVWKNGEWQAGTLTDDNVLHISEGSTALHYGQQCFEG 60 Query: 61 LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPQVETEQFVEACKQVVRANERFIPPYGT 120 LKAYRCKDGSINLFRPDQNAARMQRSCARLLMP V TE F++ACKQVV+ANE FIPPYG+ Sbjct: 61 LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTEVFIDACKQVVKANEHFIPPYGS 120 Query: 121 GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGT 180 GGALYLRPFVIG GDNIGVRTAPEFIFS+FCIPVGAYFKGGL PHNF IS+FDRAAPQGT Sbjct: 121 GGALYLRPFVIGTGDNIGVRTAPEFIFSVFCIPVGAYFKGGLVPHNFQISTFDRAAPQGT 180 Query: 181 GAAKVGGNYAASLMPGSQAKKASFADCIYLDPMTHSKIEEVGSANFFGITHDNTFVTPRS 240 GAAKVGGNYAASLMPGS+AKK+ FAD IYLDPMTHSKIEEVGSANFFGITHDN F+TP+S Sbjct: 181 GAAKVGGNYAASLMPGSEAKKSGFADAIYLDPMTHSKIEEVGSANFFGITHDNKFITPKS 240 Query: 241 PSVLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDK 300 PSVLPGITRLSLIELAK+RLGLEV+EG+VFIDKL FKEAGACGTAAVI+PIGGI Y K Sbjct: 241 PSVLPGITRLSLIELAKTRLGLEVVEGEVFIDKLDQFKEAGACGTAAVISPIGGIQYNGK 300 Query: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339 LHVFHSETEVGPITQKLYKELTGVQTGDVEAP GWIVKV Sbjct: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPQGWIVKV 339 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF3433 PS417_17565 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01123.hmm # target sequence database: /tmp/gapView.1115.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-142 460.5 0.0 1.4e-142 460.3 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF3433 PS417_17565 branched-chain amino Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF3433 PS417_17565 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 460.3 0.0 1.4e-142 1.4e-142 1 313 [] 31 339 .] 31 339 .] 0.99 Alignments for each domain: == domain 1 score: 460.3 bits; conditional E-value: 1.4e-142 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeelflealk 75 W++++l+ ++ l+++egs++lhYgq++feGlkayR++dG+i+lfRpd+na+R++rs+ rll+P++++e+f++a+k lcl|FitnessBrowser__WCS417:GFF3433 31 WQAGTLTDDNVLHISEGSTALHYGQQCFEGLKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTEVFIDACK 105 *************************************************************************** PP TIGR01123 76 qlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsifveteyvRaapkG 150 q+vka+++++p+++s+ +LYlRPf+i+t+dn+Gv++a+e++f+v++ PvGaYfkggl p ++f + ++Raap+G lcl|FitnessBrowser__WCS417:GFF3433 106 QVVKANEHFIPPYGSGGALYLRPFVIGTGDNIGVRTAPEFIFSVFCIPVGAYFKGGLVP-HNFQISTFDRAAPQG 179 ***********************************************************.8998899******** PP TIGR01123 151 tGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelvttplsesiLegvtresll 225 tGa+kvgGnYaasl++ ++a+++g++d++yldp+++ kieevG+an+f+it+d ++++tp+s+s+L+g+tr sl+ lcl|FitnessBrowser__WCS417:GFF3433 180 TGAAKVGGNYAASLMPGSEAKKSGFADAIYLDPMTHSKIEEVGSANFFGITHD-NKFITPKSPSVLPGITRLSLI 253 *****************************************************.********************* PP TIGR01123 226 elakd.lgleveereiaidelkaaveaGeivfacGtaavitPvgelkiegkevevkse.evGevtkklrdeltdi 298 elak lglev e+e+ id+l++++eaG acGtaavi+P+g+++ +gk ++++se evG++t+kl++elt++ lcl|FitnessBrowser__WCS417:GFF3433 254 ELAKTrLGLEVVEGEVFIDKLDQFKEAG----ACGTAAVISPIGGIQYNGKLHVFHSEtEVGPITQKLYKELTGV 324 ****99**********************....*************************99**************** PP TIGR01123 299 qyGkledkegWivev 313 q+G++e+++gWiv+v lcl|FitnessBrowser__WCS417:GFF3433 325 QTGDVEAPQGWIVKV 339 *************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory