Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate GFF3786 PS417_19385 GntR family transcriptional regulator
Query= BRENDA::A0A060PQX5 (417 letters) >FitnessBrowser__WCS417:GFF3786 Length = 388 Score = 246 bits (627), Expect = 1e-69 Identities = 139/393 (35%), Positives = 216/393 (54%), Gaps = 15/393 (3%) Query: 22 FSKKALGMKASEVRELLKLVESSDVISLAGGLPAPETFPVEIIAEITKEVLEKHAAQALQ 81 FS++ +K+S +RE+L + V+S AGGLPA P ++ + Q Sbjct: 3 FSERVTRLKSSLIREILAAAQRPQVMSFAGGLPAEAMLPALDWDDMPLNIG--------Q 54 Query: 82 YGTTKGFTPLRLALAEWMRKRYDIPISKVDIMITSGSQQALDLIGRVFINPGDIVVVEAP 141 YG ++G LR LA R +P +++ SGSQQALDL +++I+ G V++E P Sbjct: 55 YGMSEGEPQLRELLAAEARA-LGVPCQASQVLVVSGSQQALDLAAKLYIDKGTQVLLEGP 113 Query: 142 TYLAALQAFKYYEPEFVQIPLDDEGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNPAGV 201 TYLAALQ F+ + + + + L+ +G + L L E + +Y IPTFQNP+ V Sbjct: 114 TYLAALQIFQLFGADCLTVHLEADGPNLSALRASL-----ERHRPAFIYLIPTFQNPSAV 168 Query: 202 TMSEKRRKRLLELASEYDFLIVEDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFSKILA 261 SE +R+ + L E+ ++ED PY EL + G KPI + +Y GT SK L Sbjct: 169 RYSEAKREAVAALLDEFGVTLIEDEPYRELTFDGGSAKPIVGRLKKASWIYTGTVSKTLL 228 Query: 262 PGFRIGWIAAEPHLIRKLEIAKQSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFYKPR 321 PG R+G++ A P L L KQS DL TN Q A +++ H+ + FY+ R Sbjct: 229 PGLRVGYLIASPDLFAHLLKLKQSADLHTNRVGQWQAMQWIGSEKYQQHLVELRSFYRER 288 Query: 322 RDAMLKALEEFMPEGVRWTKPEGGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAFFAH 381 RDA AL+ + W P+GG+F W+TL + +DT+ +L A+ + VA++PGE FF+ Sbjct: 289 RDAFQAALQRHFADLADWQVPQGGLFFWLTLKQPLDTRTLLAPALEQDVAFMPGEPFFSE 348 Query: 382 RDV-KNTMRLNFTYVPEEKIREGIKRLAETIKE 413 D ++RLNF+++ ++ EG+KRLA +++ Sbjct: 349 PDQHPGSLRLNFSHIDPARLDEGLKRLAAVVRQ 381 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 388 Length adjustment: 31 Effective length of query: 386 Effective length of database: 357 Effective search space: 137802 Effective search space used: 137802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory