GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Pseudomonas simiae WCS417

Align methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) (characterized)
to candidate GFF3827 PS417_19595 3-methylcrotonyl-CoA carboxylase

Query= BRENDA::Q9I299
         (655 letters)



>lcl|FitnessBrowser__WCS417:GFF3827 PS417_19595 3-methylcrotonyl-CoA
           carboxylase
          Length = 627

 Score =  580 bits (1494), Expect = e-170
 Identities = 319/645 (49%), Positives = 415/645 (64%), Gaps = 22/645 (3%)

Query: 7   SIQRLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSY 66
           +  ++L+ANRGEIACR+ R+A+ALG  +VAV+SD D  A HV  AD AV +G A    SY
Sbjct: 3   AFSKILIANRGEIACRIQRTAQALGYRTVAVYSDADAQALHVQMADEAVHIGPAPVQQSY 62

Query: 67  LRGDRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAK 126
           L  D I+ AA  + A AI PGYGFLSEN DFARAC++AGL F+GP   AI+ MGSK  +K
Sbjct: 63  LNIDAILNAARVTSADAIPPGYGFLSENPDFARACQQAGLTFIGPSPEAIELMGSKRLSK 122

Query: 127 ALMEEAGVPLVPGYHGEAQDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEA 186
             M +AGVP + GY G AQD  T +REA  IGYP+++KA+AGGGG+GM++V+   EL + 
Sbjct: 123 LAMLDAGVPCIAGYQGSAQDDSTLQREADAIGYPLMIKASAGGGGRGMRLVQHPEELLDN 182

Query: 187 LSSAQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVE 246
           L +A+ EAK AFG   +++E+ L+ PRHVEIQ+F D HGH +YL ERDCSIQRRHQK++E
Sbjct: 183 LHTARSEAKNAFGSGELILEQALIDPRHVEIQLFGDSHGHLIYLGERDCSIQRRHQKIIE 242

Query: 247 EAPAPGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDERGQFFFMEMNTRLQVEHPVT 306
           EAP P +  ELR+AMGEAA+ A +A+ YVGAGTVEFLLD  G+F+F+EMNTRLQVEHPVT
Sbjct: 243 EAPCPVMTPELRQAMGEAALNAGRAVNYVGAGTVEFLLDRNGRFYFLEMNTRLQVEHPVT 302

Query: 307 EAITGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYRE 366
           E ITGLDLV WQ+++A G+ LPLTQ  V LNGHA+EVRLYAEDP   FLP +G ++ +  
Sbjct: 303 ELITGLDLVDWQLQIAAGQPLPLTQPDVSLNGHAMEVRLYAEDPAQGFLPQTGEVLRWDP 362

Query: 367 AAAGPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTNL 426
           AA   G R+D GV EG  +SPFYDPML K+IA+G TREEAR++LL  + +T + G+ TN 
Sbjct: 363 AA---GVRIDHGVTEGQRISPFYDPMLGKIIAYGATREEARRKLLRAVEDTVLLGVTTNQ 419

Query: 427 AFLRRILGHPAFAAAELDTGFIARHQDDLLP-APQALPEHFWQAAAEAWLQSEPGHRRDD 485
             L  +L HP F   +  TGFIA H  ++ P  P A  EH   AAA  +  S   H +  
Sbjct: 420 PLLVDLLKHPDFVGGDFSTGFIAEHFSEIRPLTPSA--EHLALAAALFYQHSANQHPQG- 476

Query: 486 DPHSPWSRNDGWRSALARESDLMLRCRDERRCVRLRHASPSQYRLDGDDLVSRVDGVTRR 545
                     GWR+  +      L    +   V   +A+P     DG       +G+ RR
Sbjct: 477 --------LAGWRNNTSAPCTYRLEVNGDTHTV---NAAPLPLTTDGRHANHVFNGIRRR 525

Query: 546 SAALRRGRQLFLEWEGELLAIEAVDPIAEAEAAHAHQGGLSAPMNGSIVRVLVEPGQTVE 605
           +A    G QL   W   L   +    +A  + A+   G + APM+G+IV V V  G +V 
Sbjct: 526 TAYHLVGNQL---WLPGLTVTDRTQQVASRQ-ANVSSGTVKAPMDGAIVDVRVSAGDSVT 581

Query: 606 AGATLVVLEAMKMEHSIRAPHAGVVKALYCSEGELVEEGTPLVEL 650
            G  L+VLEAMKMEH + A   GV+K +    G+ V     L+E+
Sbjct: 582 KGQLLLVLEAMKMEHPLTAGIDGVIKGVQVIAGDQVRNRQVLLEI 626


Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1010
Number of extensions: 41
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 655
Length of database: 627
Length adjustment: 38
Effective length of query: 617
Effective length of database: 589
Effective search space:   363413
Effective search space used:   363413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory