Align dihydrolipoyl dehydrogenase (EC 1.8.1.4) (characterized)
to candidate GFF2177 PS417_11105 pyridine nucleotide-disulfide oxidoreductase
Query= BRENDA::A0A0H2ZB32 (464 letters) >FitnessBrowser__WCS417:GFF2177 Length = 399 Score = 74.3 bits (181), Expect = 7e-18 Identities = 74/231 (32%), Positives = 112/231 (48%), Gaps = 34/231 (14%) Query: 129 VELAGGGSQRIECEHLLLAAGSQSVELP-------ILPLGGKVISSTEALAPGSLPKRLV 181 ++LA G Q + LLLA G ++ LP L + ++ AL G+ RLV Sbjct: 91 LQLADG--QWLPYAGLLLATGGRARRLPQEQAHVLYLRTHDEALALRSALKAGT---RLV 145 Query: 182 VVGGGYIGLELGTAYRKLGVEVAVVEAQPRILPGYDEELTKPVAQAL----RKLGVELYL 237 VVGGG+IGLE+ R LG EV ++EA PR+ L +++AL R+ GV++ L Sbjct: 146 VVGGGFIGLEVAATARGLGCEVTLLEAGPRLA---GRVLPPVISEALLTLHRQHGVDVRL 202 Query: 238 GHSLLGPSENGVRVRDGAGEEREIAADQVLVAVGRKPRSEGWNLESLGLDMNGRAVKVDD 297 +L + V + DG + + D V+V +G +P E + GL++ G+ ++VD Sbjct: 203 NMALESIQADAVWLVDG----QRLPCDLVVVGIGMQPNIE--LAAAAGLEV-GQGIRVDS 255 Query: 298 QCRTSMRNVWAIGD-----LAGEPMLA---HRAMAQGEMVAELIAGKRRQF 340 RTS ++A GD L GE A AQG A + G+ F Sbjct: 256 HLRTSAPGIYAAGDVCEFRLGGEYQRQETWRNAEAQGRHAALNLLGRELPF 306 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 399 Length adjustment: 32 Effective length of query: 432 Effective length of database: 367 Effective search space: 158544 Effective search space used: 158544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory