Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate GFF2657 PS417_13545 arginine aminotransferase
Query= TCDB::Q9HU32 (257 letters) >FitnessBrowser__WCS417:GFF2657 Length = 664 Score = 342 bits (876), Expect = 2e-98 Identities = 168/256 (65%), Positives = 214/256 (83%) Query: 2 AEATPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQ 61 AEA +E+ +LHKR+G++EVLKGISLTA +GDVIS++G+SGSGKST LRCIN+LE P Q Sbjct: 407 AEAKKMIEVIDLHKRFGNIEVLKGISLTAHEGDVISLIGASGSGKSTLLRCINMLEVPDQ 466 Query: 62 GQILVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRR 121 G I V GE ++L + G + AD++Q+ R+RS LG VFQNFNLWPH ++L+N+IEAP + Sbjct: 467 GSIHVDGESIKLNYGRPGAPLVADARQLVRIRSTLGMVFQNFNLWPHRTVLENLIEAPTQ 526 Query: 122 VLGKSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPT 181 VL +S+AEAIE AE LL +VG+A KR+ YPA LSGGQQQR AIAR LAM+PKV+LFDEPT Sbjct: 527 VLRESRAEAIERAEALLERVGLAAKRNEYPAFLSGGQQQRVAIARALAMRPKVMLFDEPT 586 Query: 182 SALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVF 241 SALDPE+V EVL VIR+LAEEGRTM+LVTHEM+FAR VSS+V FLHQG++EE G+P VF Sbjct: 587 SALDPELVGEVLRVIRSLAEEGRTMILVTHEMAFARDVSSKVAFLHQGMIEETGSPDAVF 646 Query: 242 ENPQSARCKQFMSSHR 257 +P+S RC+QF+++H+ Sbjct: 647 IDPRSERCRQFVNAHQ 662 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 664 Length adjustment: 31 Effective length of query: 226 Effective length of database: 633 Effective search space: 143058 Effective search space used: 143058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory