Align 3-keto-5-aminohexanoate cleavage enzyme; EC 2.3.1.247 (characterized)
to candidate GFF1426 PS417_07250 hypothetical protein
Query= SwissProt::B0VHH0 (276 letters) >FitnessBrowser__WCS417:GFF1426 Length = 310 Score = 167 bits (424), Expect = 2e-46 Identities = 105/299 (35%), Positives = 162/299 (54%), Gaps = 29/299 (9%) Query: 3 PLILTAAITGAETTRADQPNLPITPEEQAKEAKACFEAGARVIHLHIRE-DDGRPSQRLD 61 P+I+T A+TGA T + P+LPIT +E A A EAGA ++HLH R+ +DGRPSQ Sbjct: 6 PVIITCAVTGAIHTPSMSPHLPITAQEIADAAIGAAEAGAAIVHLHARDPNDGRPSQDPA 65 Query: 62 RFQEAISAIREVVPEIIIQISTGGAVGESFDKRLAP-LALKPEMATLNAGTLNFG----- 115 F E + I+ +++I I+TGGA ++RL P + KPE+A+LN G++NFG Sbjct: 66 LFAEFLPQIK-AASDVVINITTGGAPTMGVEERLQPVMQFKPELASLNMGSMNFGLYEML 124 Query: 116 -------------------DDIFINHPADIIRLAEAFKQYNVVPEVEVYESGMVDAVARL 156 D IF N DI + A + E+E Y+ G + A Sbjct: 125 NRFTDFKHDWERPYLEESDDRIFRNTFRDITHILNACAENRTRFEIECYDIGHLYTAAHF 184 Query: 157 IKKGIITQNPLHIQFVLGVPGGMSGKPKNLMYMMEHLKEEIPTA-TWAVAGIGRWHIPTS 215 +++G++ + PL IQ V G+ GG+ G P++L +M + W++ G GR IP + Sbjct: 185 LERGLL-KPPLFIQSVFGLRGGIGGHPEDLAHMRRTADRLFGSDYVWSILGAGRGQIPLA 243 Query: 216 LIAMVTGGHIRCGFEDNIFYHKGVIAESNAQLVARLARIAKEIGRPLATPEQAREILAL 274 + + G + R G ED+++ G +A SNA V R+ + + +G +ATP++AREIL L Sbjct: 244 TMGLSMGSNARVGLEDSLWDGPGKLAASNADQVRRIRTVIEALGHRVATPDEAREILGL 302 Lambda K H 0.320 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 310 Length adjustment: 26 Effective length of query: 250 Effective length of database: 284 Effective search space: 71000 Effective search space used: 71000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory