Align Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale)
to candidate GFF4493 PS417_22995 PTS N-acetyl-D-glucosamine transporter
Query= uniprot:P50829 (168 letters) >FitnessBrowser__WCS417:GFF4493 Length = 836 Score = 111 bits (278), Expect = 3e-29 Identities = 54/137 (39%), Positives = 84/137 (61%) Query: 17 EEVIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSPAEGEVIQIFHTKHAVG 76 E + +P G V+ L +VPD VF+ MG+GIA++P + + +P +G +I + T HA+ Sbjct: 7 ELTLSAPLSGPVLTLGNVPDEVFASGAMGDGIAIDPLNDCLYAPCDGVIIHVARTGHALT 66 Query: 77 IRTRSGIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITCDLELIKEKASSTVIPI 136 IR +G E+L+HVG++TV +NGEGF +K+G +V G L+ DL+ I + S V I Sbjct: 67 IRAENGAEVLMHVGIDTVELNGEGFALLVKDGARVSKGQALVQFDLDRIARQCKSLVSLI 126 Query: 137 VIMNGEAVGSMVSAGEK 153 ++ NGE AG+K Sbjct: 127 ILTNGERFELRAVAGQK 143 Lambda K H 0.314 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 168 Length of database: 836 Length adjustment: 29 Effective length of query: 139 Effective length of database: 807 Effective search space: 112173 Effective search space used: 112173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory