Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate GFF796 PS417_04045 peptide ABC transporter ATP-binding protein
Query= TCDB::Q97UG5 (617 letters) >FitnessBrowser__WCS417:GFF796 Length = 323 Score = 189 bits (479), Expect = 2e-52 Identities = 105/267 (39%), Positives = 169/267 (63%), Gaps = 9/267 (3%) Query: 355 VVMKILNLSKIYYIRKNLILSEP-INAVNDVSFELKKGTITALVGGSGHGKSTIAKILAG 413 VV+ +L++ Y + + L + A+N VSFEL+ G A+VG SG GKST+A+ L Sbjct: 3 VVLTARDLTRHYEVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALTL 62 Query: 414 MIQQTSGKIILLGKDVSEYGVRNSMWYKENVQMIFQDPYSSLDPRHTVRWHVERPLLIHK 473 + + +SG + + G++V+ +++VQM+FQ PY+SL+PR V + PLLI+ Sbjct: 63 IEEPSSGSLKIAGQEVAGADKAQRKQLRKDVQMVFQSPYASLNPRQKVGDQLAEPLLINT 122 Query: 474 KVSNKDQLLPKIIEVLKNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADE 533 +S ++ K+ ++K VGL+P ++ +YPH SGG+RQR+A+ARA ++PKVLVADE Sbjct: 123 NLSAAER-REKVQAMMKQVGLRP--EHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADE 179 Query: 534 PVSMLDASLRAGILNLIKKFKKN-GISILYITHDIATVNYIADEIMVIYKGRIVEKGNTY 592 P S LD S++A +LNL ++ + ++I+H++A V ++AD++MV+Y GR VE G Sbjct: 180 PTSALDVSIQAQVLNLFMDLQQEFNTAYVFISHNLAVVQHVADDVMVMYLGRPVEVGPKE 239 Query: 593 EVISNPSHEYTKRLIEAV----PDPYK 615 ++ + P H YT+ L+ A PDP K Sbjct: 240 DIYARPLHPYTQALLSATPTIHPDPNK 266 Score = 175 bits (443), Expect = 3e-48 Identities = 102/308 (33%), Positives = 172/308 (55%), Gaps = 9/308 (2%) Query: 13 ELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYPGVVLRGH 72 E++ G F V + V+FE+ + A+ GESGCGKSTLA A+ L++ P G Sbjct: 15 EVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALT-LIEEPS---SGS 70 Query: 73 VYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAA-VSHGVNVEEA 131 + + +++ + + ++LR K+ V Q +L+P K+GDQ+ ++ ++ E Sbjct: 71 LKIAGQEVAGADKAQRKQLR-KDVQMVFQSPYASLNPRQKVGDQLAEPLLINTNLSAAER 129 Query: 132 RKLIKEKLELVDLPYNVVNMYPHELSGGMRQRVVIATSILLNPSLIILDEPTTGLDVIVQ 191 R+ ++ ++ V L YPH SGG RQR+ +A +++L P +++ DEPT+ LDV +Q Sbjct: 130 REKVQAMMKQVGLRPEHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADEPTSALDVSIQ 189 Query: 192 YEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSKEEIIKRPSHPY 251 ++L +Q++ + V ISH+++++ ++D V +MY G VE+G KE+I RP HPY Sbjct: 190 AQVLNLFMDLQQEFNTAYVFISHNLAVVQHVADDVMVMYLGRPVEVGPKEDIYARPLHPY 249 Query: 252 TYLLISSLPSLVKRREK-LLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKCSTLNPALGDI 310 T L+S+ P++ K + I G P L+ P C F+ RCP+ +CST P L Sbjct: 250 TQALLSATPTIHPDPNKPKIKIVGELPNPLNP-PPGCAFHKRCPYATARCSTEEPQLRP- 307 Query: 311 MDGHKARC 318 +D + C Sbjct: 308 LDNRQVAC 315 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 28 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 617 Length of database: 323 Length adjustment: 32 Effective length of query: 585 Effective length of database: 291 Effective search space: 170235 Effective search space used: 170235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory